TkA02G466700 | RubberDandelionOmics

Gene overview

TkA02G466700

Reference: TK1151 Chr: Chr02 Coordinates: 119029481-119033476 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2462 bp · TkA02G466700|TK1151|cDNA

TTTTAAGAGATCCTTTGCAAATGCATGAGTTGAAAGTGTTCATATGAGAAAAAGCATCAGTTGTGTCATACAACCTTCGATAGGGAAAAGTATCGAGAAACTATAAATACTAGGATTTGACTCGGTCACAACGTAACAGATCTCCCTTTCGCCCTTCAATGACTTCCCGACCAATAACGCCGCCGTGGCAACTGCCCCCTCCTTGATTTTCCATGGCGGCAATATCCGTTAAACGCCATACCGTTCTTTCTCGCTTCAAA...

CDS

Download CDS FASTA

1908 bp · TkA02G466700|TK1151|CDS

ATGGCGGCAATATCCGTTAAACGCCATACCGTTCTTTCTCGCTTCAAAACCCTTCTACCGTCACAGTGTCTTTTCCATAAATTGATTGAAGTTGGAAATAAACCTCGATCACGTAGCGACAAGGGCTCGGATTTTGAATCAGGTGAAATCAATAGTTCAAAATGGAAAAAGATGGATTCCAGATCACTGGGGATAAGCCGAACAATGGTCCCTTCATCTCCCTATACTCTTCTAAAGATTCTCCAAAACAAAGGATTTGA...

Protein

Download Protein FASTA

635 aa · TkA02G466700|TK1151|PROTEIN

MAAISVKRHTVLSRFKTLLPSQCLFHKLIEVGNKPRSRSDKGSDFESGEINSSKWKKMDSRSLGISRTMVPSSPYTLLKILQNKGFEAYLVGGCVRDLLLNRTPKDFDVITTADLNQIKKVFHRCQIVGRRFPICIVHIKGSVIEVSSFKTLAKHSEDKEKFLVSQTPRNCDKTDLKLWKNSMHRDFTVNSLFFDPLIHKIYDYSNGMKDLLELKLRTLVPAHLSFTEDCARILRGLRIAARLGLSFSKDIETAIHKHAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G466700`
TK1151 ID	TkA02G466700
OH-1004 ID	LXL04_013878
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G466700`
Location	Chr02:119029481-119033476 (-)
Description	Similar to pcnB: Poly(A) polymerase I (Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013878` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006276 plasmid maintenance Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006397 mRNA processing Biological Process GO:0009451 RNA modification Biological Process GO:0042780 tRNA 3'-end processing Biological Process GO:0043633 polyadenylation-dependent RNA catabolic process Biological Process GO:0071047 polyadenylation-dependent mRNA catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0003723 RNA binding Molecular Function GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference	ecc:c0176 ecj:JW5808 eco:b0143 hin:HI_0063 stm:STM0184 stt:t0192 sty:STY0209 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.465

Rank 1 · TkA02G466700 · TK1151

Plastid0.254

Rank 2 · TkA02G466700 · TK1151

Nucleus0.189

Rank 3 · TkA02G466700 · TK1151

Cytoplasm0.089

Rank 4 · TkA02G466700 · TK1151

Cell membrane0.027

Rank 5 · TkA02G466700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26128Gad284-125 aa

PF01743PolyA_pol88-215 aa

PF12194Ste5_C106-176 aa

PF26128Gad2186-210 aa

PF12194Ste5_C203-216 aa

PF12627PolyA_pol_RNAbd244-305 aa

PF12627PolyA_pol_RNAbd328-339 aa

PF26128Gad2405-447 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G466700	`PF26128`	Gad2	84	125	0.011	16.4
TkA02G466700	`PF01743`	PolyA_pol	88	215	1.1e-26	94.4
TkA02G466700	`PF12194`	Ste5_C	106	176	0.34	11.5
TkA02G466700	`PF26128`	Gad2	186	210	0.011	16.4
TkA02G466700	`PF12194`	Ste5_C	203	216	0.34	11.5
TkA02G466700	`PF12627`	PolyA_pol_RNAbd	244	305	6.1e-14	52.2
TkA02G466700	`PF12627`	PolyA_pol_RNAbd	328	339	6.1e-14	52.2
TkA02G466700	`PF26128`	Gad2	405	447	0.011	16.4
TkA02G466700	`PF12194`	Ste5_C	406	434	0.34	11.5
TkA02G466700	`PF01743`	PolyA_pol	512	541	1.1e-26	94.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card