RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G465570
Reference: TK1151 Chr: Chr02 Coordinates: 118653532-118659318 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4712 bp · TkA02G465570|TK1151|cDNA

TCCATTTCATAAACAGCGAAATTACTATGAAGCCCCTACCCCGTCGACGATGGCAACTCTTCTCTCTGAGACAAAAATTTCTGATACAAATCTCTCGATTCCATGATCTGTAAACCTTTTGGTGCAGATATTATGTTCTACAAATGATTCGGCAACAGACACGTAAATAAATTTGATTACTTCATGCCGATCATTCCCACACTTCTCATCATAGATCATCGAATTCCATAATAGCATTTCGTTAGTTCTGACCCCAATTG...

CDS

Download CDS FASTA

1155 bp · TkA02G465570|TK1151|CDS

ATGGAAATTTACCAAGCAATAGCCAAGCTGGATCAGGGTGGAAAAACCGATGATATTCAGGTTTTAGTTGATGGGATTCAAGAGGATCTTGAGGTACAAATAAAAACCCTAAATGATCGCTGCAAGATGTATGGATTGCGTGGGAAACCAAATCTGTTGGTTGAGCTGCCATTTGGTTGGCAAGGTGGCATTCAAGAAGAAGCATTTGATTGGGATGAAAATTGGGATAAGTTTGAAGATGAAGGATTTACATTTGTGAA...

Protein

Download Protein FASTA

384 aa · TkA02G465570|TK1151|PROTEIN

MEIYQAIAKLDQGGKTDDIQVLVDGIQEDLEVQIKTLNDRCKMYGLRGKPNLLVELPFGWQGGIQEEAFDWDENWDKFEDEGFTFVKDLTLDVQNVIAPPKQKSCPLQHKSKNSTTGVNESVNQDKGKIVKSPPEDTSPNAVKSFSSERSFDEEEKPTFDINYDSEASWDYNAKNHKDLDGESVNGNTLFDSSSDGWNQGGLNPIRIEIPRKSTYTFDSIPGTPAYSYAGSPPRNNLFQNHYPFPAFDNSVPSTPAYSNP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G465570
TK1151 IDTkA02G465570
OH-1004 IDLXL04_013903
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)97.700
Protein coverage (%)TK1151 100.000 / OH-1004 47.466
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G465570
LocationChr02:118653532-118659318 (-)
DescriptionSimilar to itsn1: Intersectin-1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_013903 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006887 exocytosis Biological Process
GO:0006897 endocytosis Biological Process
GO:0007264 small GTPase-mediated signal transduction Biological Process
GO:0007267 cell-cell signaling Biological Process
GO:0008104 intracellular protein localization Biological Process
GO:0015031 protein transport Biological Process
GO:0016197 endosomal transport Biological Process
GO:0035025 positive regulation of Rho protein signal transduction Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0051056 regulation of small GTPase mediated signal transduction Biological Process
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction Biological Process
GO:0060124 positive regulation of growth hormone secretion Biological Process
KEGG gene cross-reference
ddi:DDB_G0287325
hsa:6453
mmu:16443
rno:29491
xla:394300
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.724
Rank 1 · TkA02G465570 · TK1151
Nucleus0.253
Rank 2 · TkA02G465570 · TK1151
Cell membrane0.115
Rank 3 · TkA02G465570 · TK1151
Golgi apparatus0.097
Rank 4 · TkA02G465570 · TK1151
Lysosome / Vacuole0.058
Rank 5 · TkA02G465570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser