TkA02G465480 | RubberDandelionOmics

Gene overview

TkA02G465480

Reference: TK1151 Chr: Chr02 Coordinates: 118635531-118637678 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1830 bp · TkA02G465480|TK1151|cDNA

TTTGGGGGCAAAAAAACTTTCTTCTTGGTTGGTTAACGAAATACGCTCATTCCACGCGTCAGACTTCCCTTTCCTATAAATCCGACTCTCCATCAACGAAAAAGGGATCCAATCTTACGCTTATGAACGCAAAACCTCATCCTTAGATCCTCCGTTTCCTGCTACTTTCCTTCCGTAATTGATTCACATCTCTCCACTTTATTCCTCATTTTCTTCTTCAATTCTGCAACATTGCGTCTTCCCGTTTCCGGGGTTTTCAT...

CDS

Download CDS FASTA

1152 bp · TkA02G465480|TK1151|CDS

ATGGGTCCTGGGACTGATGTGTGGCCTCAATGTACATCATTGGATAATCGGCATTCAAGGGAATGTATGCCTGCGATGATAGAAGATGACGATTCCGACGATTTGGATAATCTGAGCGAAACAAAGTTTGCTAAACCTCCACGAAATGGTCCGCCTGTGCGACATAGTCTCAGCGAGGCTTTATTGGTTGATACCTCTAATTTGAATTCACCAAAAGGGCCACTGTCACCACAAAATCATGTAAGCTGTGCATTTTTACC...

Protein

Download Protein FASTA

383 aa · TkA02G465480|TK1151|PROTEIN

MGPGTDVWPQCTSLDNRHSRECMPAMIEDDDSDDLDNLSETKFAKPPRNGPPVRHSLSEALLVDTSNLNSPKGPLSPQNHVSCAFLPAFRSGSCSEIGPKPYMEDEFICVDDLQQHLHAKLDHPLTGAFYGVFDGHGGVDAASFTKRNILEFIIKDCNFPNGVQKAVKNAFAKIDHELADHSSLDNSSGTTALTVLILGKNMIIANAGDCRAVLGKRGRAIELSVDHKPSCTSEKMRIEKLGGVIYDGYLNGQLSVARAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G465480`
TK1151 ID	TkA02G465480
OH-1004 ID	LXL04_013907
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G465480

Location Chr02:118635531-118637678 (+)

Description Similar to At3g51470: Probable protein phosphatase 2C 47

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51470`	Probable protein phosphatase 2C 47.	No verified direct reference in this release
`At2g33700`	Confers salt tolerance by triggering the expression of stress-responsive genes.	AtPP2CG1, a protein phosphatase 2C, positively regulates salt tolerance of Arabidopsis in abscisic acid-dependent manner.2012 · DOI: 10.1016/j.bbrc.2012.05.064
`At2g25620`	Probable protein phosphatase 2C 22.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0597200`	Probable protein phosphatase 2C 57.	No verified direct reference in this release
`Os01g0295700`	Probable protein phosphatase 2C 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013907 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0050688 regulation of defense response to virus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G25620

ath:AT2G33700

ath:AT3G51470

dosa:Os02g0799000

dosa:Os06g0597200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.493

Rank 1 · TkA02G465480 · TK1151

Nucleus0.489

Rank 2 · TkA02G465480 · TK1151

Cell membrane0.140

Rank 3 · TkA02G465480 · TK1151

Lysosome / Vacuole0.049

Rank 4 · TkA02G465480 · TK1151

Endoplasmic reticulum0.047

Rank 5 · TkA02G465480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481PP2C101-341 aa

PF19752DUF6239180-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G465480	`PF00481`	PP2C	101	341	3e-71	240.8
TkA02G465480	`PF19752`	DUF6239	180	220	0.41	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD02`	Arabidopsis thaliana	sp\|Q9SD02\|P2C47_ARATH Probable protein phosphatase 2C 47	63.300%	Swiss-Prot	High
`P93006`	Arabidopsis thaliana	sp\|P93006\|P2C27_ARATH Probable protein phosphatase 2C 27	61.000%	Swiss-Prot	High
`Q9SLA1`	Arabidopsis thaliana	sp\|Q9SLA1\|P2C22_ARATH Probable protein phosphatase 2C 22	49.900%	Swiss-Prot	Medium
`Q69VD9`	Oryza sativa subsp. japonica	sp\|Q69VD9\|P2C57_ORYSJ Probable protein phosphatase 2C 57	54.500%	Swiss-Prot	High
`Q9FYN7`	Oryza sativa subsp. japonica	sp\|Q9FYN7\|P2C02_ORYSJ Probable protein phosphatase 2C 2	52.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card