TkA02G463910 | RubberDandelionOmics

Gene overview

TkA02G463910

Reference: TK1151 Chr: Chr02 Coordinates: 118238282-118241000 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2209 bp · TkA02G463910|TK1151|cDNA

TTGGCATTTTACCAAAAAAACCGAAGAATCCCAAGTTGGGTTGTTGACGAGGCTCTGACACATCACAATCCATTCTTTTTGTTTTTTTTTTAATTAATTTTGGCATCTGAACTTTTTTTTATCACGACACATGATCGGAGCACCAACAATTTCACCTACTTTACACAATTTCGTTCGCTAATCAGCGATCATCGACAGCTAAATGTTATCACAACCGGATTCTACTGAATCTTTACCGCTTGCGACGCCGGAATCCGCCG...

CDS

Download CDS FASTA

1431 bp · TkA02G463910|TK1151|CDS

ATGTTATCACAACCGGATTCTACTGAATCTTTACCGCTTGCGACGCCGGAATCCGCCGTCCGCGAACCACCGCCGTCAACCTCCTCCGAAGATTTCTTCTCTTCCGCTTCCCTCGCATGTGCCTCTGGCTCTGCCTCCTCCCCCTCCTTATCAGACGAGAACCAAAAACCCTTTCCTTCCCCTGATCCTTCTCAAAATCGTCCTCAGATCCCCATTACATGGCCGTCTGGTGGTGCTCTAACCCTAGATTGGGTCACAAA...

Protein

Download Protein FASTA

476 aa · TkA02G463910|TK1151|PROTEIN

MLSQPDSTESLPLATPESAVREPPPSTSSEDFFSSASLACASGSASSPSLSDENQKPFPSPDPSQNRPQIPITWPSGGALTLDWVTNLMSTFDWASRNLRPSELPTVLSVEVFDALVLTASKILHKEPNCVPIEPDRDGTAGSSVVVVGDVHGQLHDVLFLLKDAGFPSENRFFVFNGDYVDRGAWGLETFLILLAWKVFMPQRVFLLRGNHESKYCTSVYGFEKEVLAKYGEKIDGKHVYRKCLGCFEGLPLASIIAGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G463910`
TK1151 ID	TkA02G463910
OH-1004 ID	LXL04_013923
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G463910

Location Chr02:118238282-118241000 (-)

Description Similar to PP7: Serine/threonine-protein phosphatase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63870`	Phosphatase active on para-nitrophenylphosphate (pNPP) and on various phosphoproteins such as myelin basic protein.	No verified direct reference in this release
`At1g48120`	Maybe required to maintain cell division activity in meristematic cells.	No verified direct reference in this release
`At5g10900`	Serine/threonine-protein phosphatase 7 inactive homolog.	No verified direct reference in this release
`At2g42810`	Isoform 2 dephosphorylates phosphorylated phytochromes, with a preference toward Pfr forms, and enhances phytochrome-mediated photoresponses, probably by enhancing their stability and their binding affinity for light signal transducers such as NDPK2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013923 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0009408 response to heat Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009785 blue light signaling pathway Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010019 chloroplast-nucleus signaling pathway Biological Process

GO:0032544 plastid translation Biological Process

GO:1902325 negative regulation of chlorophyll biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G48120

ath:AT2G42810

ath:AT5G10900

ath:AT5G63870

sly:543849

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.569

Rank 1 · TkA02G463910 · TK1151

Nucleus0.463

Rank 2 · TkA02G463910 · TK1151

Cell membrane0.106

Rank 3 · TkA02G463910 · TK1151

Endoplasmic reticulum0.064

Rank 4 · TkA02G463910 · TK1151

Lysosome / Vacuole0.048

Rank 5 · TkA02G463910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00149Metallophos145-372 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G463910	`PF00149`	Metallophos	145	372	3.1e-31	110.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN02`	Arabidopsis thaliana	sp\|Q9FN02\|PPP7_ARATH Serine/threonine-protein phosphatase 7	74.600%	Swiss-Prot	High
`Q9LNG5`	Arabidopsis thaliana	sp\|Q9LNG5\|PPP7L_ARATH Serine/threonine-protein phosphatase 7 long form homolog	56.700%	Swiss-Prot	High
`Q9LEV0`	Arabidopsis thaliana	sp\|Q9LEV0\|PPP7I_ARATH Serine/threonine-protein phosphatase 7 inactive homolog	46.200%	Swiss-Prot	Medium
`Q84XU2`	Arabidopsis thaliana	sp\|Q84XU2\|PPP5_ARATH Serine/threonine-protein phosphatase 5	38.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card