TkA02G463850 | RubberDandelionOmics

Gene overview

TkA02G463850

Reference: TK1151 Chr: Chr02 Coordinates: 118195368-118198867 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1866 bp · TkA02G463850|TK1151|cDNA

AAAATTACTATTCACAAGACTCTTCCAAAATTAATATATATAGTATAATAACGTCACACAAAAATGGCACGAATGAAAAAGTATCAAGGAAGTAAACCAAAAAGTTGACAGCGTTCTGTCGATTCTCGTTCTTTAACCTTTTCGTTCTAGTTTTCCACAATAATATTCTGGATTCTTCGTCGTTTATCTCCCACCAAAAAAATTAAAATTGGACTATAACTTCTTTGAATCTAAATCTTTGAACCGAATGTGGATTTGTC...

CDS

Download CDS FASTA

1185 bp · TkA02G463850|TK1151|CDS

ATGGGGTTTGTAGATCTGTTTTCTGCTGCTTCTATGCCAATTCTCAAAGTTCTGATAGTTACTGCACTTGGCTCTGTTCTTGCCCTGGATTCTATTGATCTCTTGGGACAAACTACGAGGAAGCAAGTCAATAATATTGTGTTCTTTGTGTTCAGTCCAGCACTTGTGGGCAGCAATCTGGCTAGTACTATCACACTTGAAAGCATCATTTCCATGTGGTTTATGCCTGTTAATATTCTGATAACATTCATAATTGGGTC...

Protein

Download Protein FASTA

394 aa · TkA02G463850|TK1151|PROTEIN

MGFVDLFSAASMPILKVLIVTALGSVLALDSIDLLGQTTRKQVNNIVFFVFSPALVGSNLASTITLESIISMWFMPVNILITFIIGSALGWVLLIIARPPQHLKGLILGACAAGNMGNLPLIIIPAVCKEKGSPFGDPDVCHEYAMAYASLSLAIGAIYLWTYVYNLVRVFSGQPQDSGNNVVKETQTMQDDLTEILLPSSSSTLNQKVKVMLNTMKQHLLYFSRMINLKTLFAPSTNGAIVGFVVGTIAPMRKLLIGTT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G463850`
TK1151 ID	TkA02G463850
OH-1004 ID	LXL04_013925
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G463850

Location Chr02:118195368-118198867 (-)

Description Similar to PILS3: Protein PIN-LIKES 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76520`	Involved in cellular auxin homeostasis by regulating auxin metabolism.	No verified direct reference in this release
`At1g20925`	Involved in cellular auxin homeostasis by regulating auxin metabolism.	No verified direct reference in this release
`At1g76530`	Involved in cellular auxin homeostasis by regulating auxin metabolism.	No verified direct reference in this release
`At5g65980`	Involved in cellular auxin homeostasis by regulating auxin metabolism.	No verified direct reference in this release
`At2g17500`	Involved in cellular auxin homeostasis by regulating auxin metabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013925 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010311 lateral root formation Biological Process

GO:0040009 regulation of growth rate Biological Process

GO:0080162 endoplasmic reticulum to cytosol auxin transport Biological Process

GO:0140964 intracellular auxin homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G20925

ath:AT1G76520

ath:AT1G76530

ath:AT2G17500

ath:AT5G65980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.302

Rank 1 · TkA02G463850 · TK1151

Cell membrane0.286

Rank 2 · TkA02G463850 · TK1151

Lysosome / Vacuole0.201

Rank 3 · TkA02G463850 · TK1151

Golgi apparatus0.100

Rank 4 · TkA02G463850 · TK1151

Cytoplasm0.076

Rank 5 · TkA02G463850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19683DUF61858-114 aa

PF03547Mem_trans10-385 aa

PF19683DUF6185317-354 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G463850	`PF19683`	DUF6185	8	114	0.13	11.1
TkA02G463850	`PF03547`	Mem_trans	10	385	4.1e-68	230.2
TkA02G463850	`PF19683`	DUF6185	317	354	0.13	11.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9K5`	Arabidopsis thaliana	sp\|Q9C9K5\|PILS3_ARATH Protein PIN-LIKES 3	56.700%	Swiss-Prot	High
`F4HWB6`	Arabidopsis thaliana	sp\|F4HWB6\|PILS1_ARATH Protein PIN-LIKES 1	55.100%	Swiss-Prot	High
`Q9C9K4`	Arabidopsis thaliana	sp\|Q9C9K4\|PILS4_ARATH Protein PIN-LIKES 4	48.400%	Swiss-Prot	Medium
`Q9FKY4`	Arabidopsis thaliana	sp\|Q9FKY4\|PILS7_ARATH Protein PIN-LIKES 7	47.100%	Swiss-Prot	Medium
`Q9SHL8`	Arabidopsis thaliana	sp\|Q9SHL8\|PILS5_ARATH Protein PIN-LIKES 5	44.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card