Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1683 bp · TkA02G463440|TK1151|cDNA
TCAGACAACTTAATAGAATAATATTTCGGAAGTCGACCCTAATTATTTTGCATTAATTTACATTTTAGAATCAAAATATTCCAATCGAATCGTTTGAAGGAAATACTTCGAAAGTTGCTTCCTACGATGCTATGATTGCTATCAGACAAAACAAACACGGCCTCAACTCGTTTTGAAATCTTAATTTCAATGGTGGGCCCTTTTATTCAGGTTCCGTTCGAAAGTAACCGTTGACCGGTATAAATTCTTTATCGCGAAGA...
825 bp · TkA02G463440|TK1151|CDS
ATGGATTACAGAACTTTAGACCTGACACTCGTCTCCGCAAAAGGGATCAAGAAATCATCTTTCATCGGAACACCAGACGTCTACGCCGTAGCTTATATCTCCGGCACAGCCAACAAACAAAAGCTTAGAACACCTGTTGATAAAGATGGAGGTTCCAACCCAACCTGGAACTTCCCCATGAAGTTTACTGTCGAAGAAGCCGCCGCCATACAGAACCGCCTGACGCTCATCGTCGAGATCAAGTCCGTCGGGACGTTCAG...
Protein
Download Protein FASTA274 aa · TkA02G463440|TK1151|PROTEIN
MDYRTLDLTLVSAKGIKKSSFIGTPDVYAVAYISGTANKQKLRTPVDKDGGSNPTWNFPMKFTVEEAAAIQNRLTLIVEIKSVGTFSDKSLGEVHVPVKELLESVSTEGKAQQVVSYQVRRHGKSKGFLSFSYKFGEKFTGKAEEPVTAYPPGMAAGSSSAYAPPYESAGRYYQQPAAGYPAQPQAGYAYQHQQQPGYGGYPPPPPPGYGGYPPQQGYGNPAVQQPPKKNRLGMGLGAGLLGGALGGLLIGDMVSDAGGG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G463440 |
|---|---|
| TK1151 ID | TkA02G463440 |
| OH-1004 ID | LXL04_005918 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 68.300 |
| Protein coverage (%) | TK1151 95.620 / OH-1004 63.524Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G463440 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:118064012-118066740 (+) | |||||||||
| Description | Similar to SRC2: Protein SRC2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006623 protein targeting to vacuole Biological Process GO:0006869 lipid transport Biological Process GO:0006952 defense response Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0000326 protein storage vacuole Cellular Component GO:0005576 extracellular region Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0032586 protein storage vacuole membrane Cellular Component GO:0003723 RNA binding Molecular Function GO:0008289 lipid binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G09070 ath:AT3G55470 ath:AT5G11100 gmx:547451 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00168C25-106 aaPF09849DUF207695-245 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G463440 | PF00168 | C2 | 5 | 106 | 2.1e-14 | 54.3 |
| TkA02G463440 | PF09849 | DUF2076 | 95 | 245 | 0.74 | 10.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.