TkA02G460440 | RubberDandelionOmics

Gene overview

TkA02G460440

Reference: TK1151 Chr: Chr02 Coordinates: 117319209-117320115 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

829 bp · TkA02G460440|TK1151|cDNA

ACCCTATTGTTGTAAGTTGTAACTATATGATGAGATTAAAACCGATGAAGGACAGAAATGAACATTTTAGAAAAGTGGAGGTTGAATGACTTGAATCACAGTCGGTGATCGCCTATGTAATTCTCACCGAGAGAGACATCGAAGATACCACCGCCAAGAATAAACTCGACGTCTCAAAACAACTCGCACTCACCCATCTTCCTTTCAGTTGCTTCCTCTTCTGTTACACCATAGCAATCACATCTTTCCCTTCATTCCCA...

CDS

Download CDS FASTA

351 bp · TkA02G460440|TK1151|CDS

ATGTTCTTCGGGGCCGTTCAATTGGGAATAATGGCGGCCTGTGTAGTCTTGTTTGTGCCAATGGCTATGGCGGGATGGCATCTCAGCCGTAATAAAGTCCTCTTCTTCAGCGGCGCTCTTTTCATCAGTCTGGCTGTCTGTATTCACCTCATACCTTATTTCCCTTCCGTTTTCTCCCCTTCTCCGACTGTTCTATTACAACAAGATCCCACCACTCCTTGCATTTCCTTAATAAACGAGAAATTGAGTCGGATCGATGT...

Protein

Download Protein FASTA

117 aa · TkA02G460440|TK1151|PROTEIN

MFFGAVQLGIMAACVVLFVPMAMAGWHLSRNKVLFFSGALFISLAVCIHLIPYFPSVFSPSPTVLLQQDPTTPCISLINEKLSRIDVSDLLNGSWVVVAGDSQARLFVVSLLDLVLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G460440`
TK1151 ID	TkA02G460440
OH-1004 ID	LXL04_013956
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.800
Protein coverage (%)	TK1151 100.000 / OH-1004 42.183 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G460440

Location Chr02:117319209-117320115 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03210`	Component of the plant cell wall polysaccharide acetylation pathway.	The role of the plant-specific ALTERED XYLOGLUCAN9 protein in Arabidopsis cell wall polysaccharide O-acetylation.2015 · DOI: 10.1104/pp.114.256479 Xyloglucan O-acetyltransferases from Arabidopsis thaliana and Populus trichocarpa catalyze acetylation of fucosylated galactose residues on xyloglucan side chains.2018 · DOI: 10.1007/s00425-018-2972-0

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013956 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045492 xylan biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005796 Golgi lumen Cellular Component

GO:0016407 acetyltransferase activity Molecular Function

GO:1990538 xylan O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G03210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.512

Rank 1 · TkA02G460440 · TK1151

Golgi apparatus0.202

Rank 2 · TkA02G460440 · TK1151

Nucleus0.197

Rank 3 · TkA02G460440 · TK1151

Cytoplasm0.120

Rank 4 · TkA02G460440 · TK1151

Cell membrane0.079

Rank 5 · TkA02G460440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12911OppC_N7-17 aa

PF24377DUF753311-52 aa

PF12911OppC_N21-55 aa

PF00689Cation_ATPase_C24-63 aa

PF24957DrmE_C58-107 aa

PF19369DUF594478-112 aa

PF12911OppC_N105-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G460440	`PF12911`	OppC_N	7	17	0.15	12.7
TkA02G460440	`PF24377`	DUF7533	11	52	0.025	15.3
TkA02G460440	`PF12911`	OppC_N	21	55	0.15	12.7
TkA02G460440	`PF00689`	Cation_ATPase_C	24	63	0.25	11.9
TkA02G460440	`PF24957`	DrmE_C	58	107	0.049	13.9
TkA02G460440	`PF19369`	DUF5944	78	112	0.0027	18.0
TkA02G460440	`PF12911`	OppC_N	105	111	0.15	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9N9`	Arabidopsis thaliana	sp\|Q9M9N9\|AXY9_ARATH Protein ALTERED XYLOGLUCAN 9	49.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card