TkA02G457390 | RubberDandelionOmics

Gene overview

TkA02G457390

Reference: TK1151 Chr: Chr02 Coordinates: 116563614-116564618 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

927 bp · TkA02G457390|TK1151|cDNA

AAGCAGAATTCGGTAGCAATGTAAAGGCTCTAATCAGATTACAACATCCACATTTGGTAGCCATGTTAGGGTTTTGCACAGAGCTTAAATGCATCGTATTTGAATACATGCACGGAAGCTCTTTGAGGAATGTCCTCTTCTCCAATTCTCGGAAAAAACAAGCTTTAAACTGGCATTCGAGAGTCTGTATTGCAGCAGAAGTATGTTCAGGGTTGACTTTTCTCCATCTCTCCAAACCCAATCCCATCGTTCACGGCAAT...

CDS

Download CDS FASTA

375 bp · TkA02G457390|TK1151|CDS

ATGTTAGGGTTTTGCACAGAGCTTAAATGCATCGTATTTGAATACATGCACGGAAGCTCTTTGAGGAATGTCCTCTTCTCCAATTCTCGGAAAAAACAAGCTTTAAACTGGCATTCGAGAGTCTGTATTGCAGCAGAAGTATGTTCAGGGTTGACTTTTCTCCATCTCTCCAAACCCAATCCCATCGTTCACGGCAATCTGAACGTGTTCAATATACTTTTGGACCGCAATAATGTCGCGAAACTACACGGATTTCGTCT...

Protein

Download Protein FASTA

124 aa · TkA02G457390|TK1151|PROTEIN

MLGFCTELKCIVFEYMHGSSLRNVLFSNSRKKQALNWHSRVCIAAEVCSGLTFLHLSKPNPIVHGNLNVFNILLDRNNVAKLHGFRLHSSYNEFEIRSDIKDFGSLVLQLLTGRNWCGLPDEVN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G457390`
TK1151 ID	TkA02G457390
OH-1004 ID	LXL04_014012
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 15.938 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G457390

Location Chr02:116563614-116564618 (-)

Description Similar to PUB50: Putative U-box domain-containing protein 50

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g66880`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014012 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G19410

ath:AT2G45910

ath:AT5G61550

ath:AT5G65500

dosa:Os06g0163000

osa:4340220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.514

Rank 1 · TkA02G457390 · TK1151

Nucleus0.331

Rank 2 · TkA02G457390 · TK1151

Cell membrane0.262

Rank 3 · TkA02G457390 · TK1151

Endoplasmic reticulum0.043

Rank 4 · TkA02G457390 · TK1151

Golgi apparatus0.040

Rank 5 · TkA02G457390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr2-91 aa

PF01705CX9-51 aa

PF00069Pkinase10-90 aa

PF14531Kinase-like21-86 aa

PF01163RIO158-79 aa

PF19974TCAD960-79 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G457390	`PF07714`	PK_Tyr_Ser-Thr	2	91	3.7e-12	46.8
TkA02G457390	`PF01705`	CX	9	51	0.22	12.8
TkA02G457390	`PF00069`	Pkinase	10	90	4.1e-07	30.4
TkA02G457390	`PF14531`	Kinase-like	21	86	0.15	12.0
TkA02G457390	`PF01163`	RIO1	58	79	0.12	12.7
TkA02G457390	`PF19974`	TCAD9	60	79	0.34	10.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HQ17`	Arabidopsis thaliana	sp\|F4HQ17\|LRL14_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.4	36.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card