TkA02G457360 | RubberDandelionOmics

Gene overview

TkA02G457360

Reference: TK1151 Chr: Chr02 Coordinates: 116552084-116556159 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1848 bp · TkA02G457360|TK1151|cDNA

AAAAAATTCCAATAAACAGTCCGATTTTATCAAGTAAAGAAATCTAACAAGTTGTGGTCCCTTTGAACTGGTCGGTGTTTATATAGGGTCGAATGCGTCGACTTGACAATCTGTATGTGATCGGGAAAAATGGTGTCGGTAAAGGCAATAGATGTGGTGAAGAATGAGCTACCAGTGGATGAGGAGTCGGTCGTGTTATCCGGTGACGTCCGCACCCGTCTAGTCCTCGTCGATATCGTTAACGGCTTCTGTACCGTTGG...

CDS

Download CDS FASTA

744 bp · TkA02G457360|TK1151|CDS

ATGGTGTCGGTAAAGGCAATAGATGTGGTGAAGAATGAGCTACCAGTGGATGAGGAGTCGGTCGTGTTATCCGGTGACGTCCGCACCCGTCTAGTCCTCGTCGATATCGTTAACGGCTTCTGTACCGTTGGTGCTGGTAATCTGGCTCCAAGAGCGCCCGATAAGCAAATATCTGGAATGGTTGATGAATCGACAAAACTTGCTAGATTGTTTTGTGAAAAGGAATGGCCGGTGTTTGCTTTCCTTGATTCTCATCATCC...

Protein

Download Protein FASTA

247 aa · TkA02G457360|TK1151|PROTEIN

MVSVKAIDVVKNELPVDEESVVLSGDVRTRLVLVDIVNGFCTVGAGNLAPRAPDKQISGMVDESTKLARLFCEKEWPVFAFLDSHHPDIPEPPYPPHCITGTDESNLVPALQWLENESNVTLRRKDCIDGFLGSVEKDGSNVFVDWVKKHKIEVLLVVGICTDVCVLDFTCSALSTRNRGFLTPLKDVIVYSRACATFDLPLNVAKNIPGALAHPQELMHHVGLYMAKSRGAKVVSEVSFASSKVNF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G457360`
TK1151 ID	TkA02G457360
OH-1004 ID	LXL04_014010
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.400
Protein coverage (%)	TK1151 98.785 / OH-1004 99.592 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G457360

Location Chr02:116552084-116556159 (-)

Description Similar to NIC1: Nicotinamidase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22570`	May catalyze nicotinamide deamidation in the NAD⁺ salvage pathway.	Nicotinamidase participates in the salvage pathway of NAD biosynthesis in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2006.03013.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014010 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006769 nicotinamide metabolic process Biological Process

GO:0006805 xenobiotic metabolic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0019363 pyridine nucleotide biosynthetic process Biological Process

GO:0019365 pyridine nucleotide salvage Biological Process

GO:0046677 response to antibiotic Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008198 ferrous iron binding Molecular Function

GO:0008936 nicotinamidase activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

aci:ACIAD3584

ath:AT2G22570

bsu:BSU31760

mtu:Rv2043c

mtv:RVBD_2043c

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.591

Rank 1 · TkA02G457360 · TK1151

Nucleus0.280

Rank 2 · TkA02G457360 · TK1151

Plastid0.114

Rank 3 · TkA02G457360 · TK1151

Cell membrane0.072

Rank 4 · TkA02G457360 · TK1151

Endoplasmic reticulum0.071

Rank 5 · TkA02G457360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00857Isochorismatase31-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G457360	`PF00857`	Isochorismatase	31	199	7e-21	75.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S8F9`	Arabidopsis thaliana	sp\|Q8S8F9\|NIC1_ARATH Nicotinamidase 1	68.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card