Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1528 bp · TkA02G451270|TK1151|cDNA
CGGCAATAGAATCAGACTACATGACGGGTTGACCCTTTCGGGATTCCCAAGAAAAATACTATCTTTATCCCTGATCCCGTCCCAATCAATCTTTTCTCCTAACGTGTTGTTGTTGTTGTCAACATTGGCGTACCGACTGTATGCTTGTATAGGCAATGCAAAACATGATCACGGCTTCCAAACTCAAATTTACTTCTCCAGTTTTCTGATTGACCCCAGAGTCGTCGTCTTATTTTCCCTCCTTTATAAAGTTTTTGCAT...
963 bp · TkA02G451270|TK1151|CDS
ATGTCTTCGATTGATCTGGAATCTATTTCGGAGGCCACATCAGGAGCAATTGGAGCTGTTCTAAGCACAACCATCTTGTACCCTCTTGACACCTGTAAAGCTAAGTATCAAGCTGAGGTTCGCACTCATGGTCGGCAGAAATACCGGAATCTATCAGATGTGTTGTTGGAGGCAGTATCCAGTGGTCGAGTTTTATCATTATATCAAGGCCTTGGAACAAAGAATTTGCAATCTTTTATTGCACAATTTGTATACTTTTA...
Protein
Download Protein FASTA320 aa · TkA02G451270|TK1151|PROTEIN
MSSIDLESISEATSGAIGAVLSTTILYPLDTCKAKYQAEVRTHGRQKYRNLSDVLLEAVSSGRVLSLYQGLGTKNLQSFIAQFVYFYGYSYFKRLYQVKYGTKNIGTKANLLLAASAGACTAIITQPLDTASSRMQTSAFGRSKGLWAMLTEGSWIEAFDGLGISLLLTSNPAIQYTVFDQLKQRLLDGKMKKSGNGSSPESLSAFSAFLLGAISKSIATVLTYPAIRCKVMIQAAESSDEETKENKKKPRKTILSVLDA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G451270 |
|---|---|
| TK1151 ID | TkA02G451270 |
| OH-1004 ID | LXL04_014137 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G451270 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:114799381-114802018 (+) | |||||||||
| Description | Similar to PNC1: Peroxisomal adenine nucleotide carrier 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0001561 fatty acid alpha-oxidation Biological Process GO:0006635 fatty acid beta-oxidation Biological Process GO:0007031 peroxisome organization Biological Process GO:0015866 ADP transport Biological Process GO:0015867 ATP transport Biological Process GO:0015908 fatty acid transport Biological Process GO:0035349 coenzyme A transmembrane transport Biological Process GO:0035350 FAD transmembrane transport Biological Process GO:0043132 NAD transport Biological Process GO:0080024 indolebutyric acid metabolic process Biological Process GO:0080121 AMP transport Biological Process GO:0090351 seedling development Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G05290 ath:AT5G27520 gmx:100301879 hsa:10478 mmu:20524 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00153Mito_carr8-97 aaPF23000ChitinSynthase_IV_N90-126 aaPF00153Mito_carr109-188 aaPF09384UTP15_C149-217 aaPF00153Mito_carr203-296 aaPF09384UTP15_C246-285 aaPF03201HMD251-297 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G451270 | PF00153 | Mito_carr | 8 | 97 | 1.2e-40 | 137.8 |
| TkA02G451270 | PF23000 | ChitinSynthase_IV_N | 90 | 126 | 0.015 | 14.9 |
| TkA02G451270 | PF00153 | Mito_carr | 109 | 188 | 1.2e-40 | 137.8 |
| TkA02G451270 | PF09384 | UTP15_C | 149 | 217 | 0.21 | 12.0 |
| TkA02G451270 | PF00153 | Mito_carr | 203 | 296 | 1.2e-40 | 137.8 |
| TkA02G451270 | PF09384 | UTP15_C | 246 | 285 | 0.21 | 12.0 |
| TkA02G451270 | PF03201 | HMD | 251 | 297 | 0.08 | 13.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.