TkA02G450610 | RubberDandelionOmics

Gene overview

TkA02G450610

Reference: TK1151 Chr: Chr02 Coordinates: 114624750-114627931 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1806 bp · TkA02G450610|TK1151|cDNA

CCGCTTTGAACCTATGTCTTTTCAGGGTTCAATTGTAAACTTAACTAACCCATATTTAACTTGAGTTGATAATATTTCAAATGGACGGCCAACTTGACTAAAACCGGGGTGATCAATCGGCTTAAATCAGGCACAACCAAAGTGACCATGGACTAGACCCTGTGATCACCAGATAAAGACACGGGTGGAACCGGTTTCCTTTACACAACACAAACGACAATCAAATCTAATCTTGCAGTATTTCCGGCGAACGCTGCTGC...

CDS

Download CDS FASTA

1302 bp · TkA02G450610|TK1151|CDS

GGTTTCCTTTACACAACACAAACGACAATCAAATCTAATCTTGCAGTATTTCCGGCGAACGCTGCTGCGTCGGAGCGTACAGAATCACTTCTCTCACTCCACTCCGATTCCCTTCAACACCTGACGCCGGTAGTTTCTTACACCGTTTTCTACTCCGTTTCACCGGTAAGGTCTCCACTCTCTTCTGTTCTTCTTCCTTTCTGTTTCTCTGGATTTGTTTACAGATTGAGTGTCGCTGACGGCAACGGGTTTCGAAAATT...

Protein

Download Protein FASTA

433 aa · TkA02G450610|TK1151|PROTEIN

GFLYTTQTTIKSNLAVFPANAAASERTESLLSLHSDSLQHLTPVVSYTVFYSVSPVRSPLSSVLLPFCFSGFVYRLSVADGNGFRKFPRCLYQDLRRRRLGRCGRRLGFLLEGNFETTYSSNAMPALKKTEPGDIRQLFERLMKEIGEPAEFELPDSLNKWKPNYTIIKRNIYLTKKVKKRVREEDDGIFCSCTSTPGSSAACGRDCHCGMLLSSCSSNCKCDNSCLNKPFHRRPMKKMKIVQTEKCGSGVVAEENIRHG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G450610`
TK1151 ID	TkA02G450610
OH-1004 ID	LXL04_016334
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	82.100
Protein coverage (%)	TK1151 94.226 / OH-1004 67.816 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G450610

Location Chr02:114624750-114627931 (+)

Description Similar to ASHH3: Histone-lysine N-methyltransferase ASHH3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44150`	Histone methyltransferase.	No verified direct reference in this release
`At3g59960`	Histone methyltransferase.	No verified direct reference in this release
`At4g30860`	Histone methyltransferase (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016334 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006298 mismatch repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006368 transcription elongation by RNA polymerase II Biological Process

GO:0007281 germ cell development Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0010569 regulation of double-strand break repair via homologous recombination Biological Process

GO:0010793 regulation of mRNA export from nucleus Biological Process

GO:0018023 peptidyl-lysine trimethylation Biological Process

KEGG gene cross-reference

ath:AT2G44150

ath:AT4G30860

dme:Dmel_CG1716

hsa:29072

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.593

Rank 1 · TkA02G450610 · TK1151

Cytoplasm0.343

Rank 2 · TkA02G450610 · TK1151

Mitochondrion0.086

Rank 3 · TkA02G450610 · TK1151

Cell membrane0.058

Rank 4 · TkA02G450610 · TK1151

Endoplasmic reticulum0.041

Rank 5 · TkA02G450610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17907AWS200-234 aa

PF00856SET211-223 aa

PF00856SET248-354 aa

PF17907AWS296-302 aa

PF17907AWS363-374 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G450610	`PF17907`	AWS	200	234	0.02	15.7
TkA02G450610	`PF00856`	SET	211	223	9.8e-27	94.2
TkA02G450610	`PF00856`	SET	248	354	9.8e-27	94.2
TkA02G450610	`PF17907`	AWS	296	302	0.02	15.7
TkA02G450610	`PF17907`	AWS	363	374	0.02	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q945S8`	Arabidopsis thaliana	sp\|Q945S8\|ASHH3_ARATH Histone-lysine N-methyltransferase ASHH3	63.800%	Swiss-Prot	High
`Q9M1X9`	Arabidopsis thaliana	sp\|Q9M1X9\|ASHH4_ARATH Putative histone-lysine N-methyltransferase ASHH4	56.000%	Swiss-Prot	High
`Q949T8`	Arabidopsis thaliana	sp\|Q949T8\|ASHR3_ARATH Histone-lysine N-methyltransferase ASHR3	50.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card