TkA02G449640 | RubberDandelionOmics

Gene overview

TkA02G449640

Reference: TK1151 Chr: Chr02 Coordinates: 114382757-114383679 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

435 bp · TkA02G449640|TK1151|cDNA

ATGGCTTCCCTATCCCTCCTATCCCGTCCACCTCTCTCTTCCTCCCTTCTCCGCCACCACCACAATGCCGCCATCGCTACCCCCGCCCGCCTTGCCACCTTCAATTCTCCTCGATATCTCTCCATTAAAGCCTTCTCTGCCCCAACCCCTGTCCAACCACTAACCCAAGACGATCTGAAAAAACTCGCCGCCGACAAGGCCGTAGAGTATGTCAGCTCCGGGATGGTTCTCGGACTCGGCACCGGTTCCACCGCCGCCTT...

CDS

Download CDS FASTA

435 bp · TkA02G449640|TK1151|CDS

ATGGCTTCCCTATCCCTCCTATCCCGTCCACCTCTCTCTTCCTCCCTTCTCCGCCACCACCACAATGCCGCCATCGCTACCCCCGCCCGCCTTGCCACCTTCAATTCTCCTCGATATCTCTCCATTAAAGCCTTCTCTGCCCCAACCCCTGTCCAACCACTAACCCAAGACGATCTGAAAAAACTCGCCGCCGACAAGGCCGTAGAGTATGTCAGCTCCGGGATGGTTCTCGGACTCGGCACCGGTTCCACCGCCGCCTT...

Protein

Download Protein FASTA

144 aa · TkA02G449640|TK1151|PROTEIN

MASLSLLSRPPLSSSLLRHHHNAAIATPARLATFNSPRYLSIKAFSAPTPVQPLTQDDLKKLAADKAVEYVSSGMVLGLGTGSTAAFVFVFGPSLFHNSADVKKQTVFFLQTADVWSTSSAAEACRCGPQTADVLASKKQTAPK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G449640`
TK1151 ID	TkA02G449640
OH-1004 ID	LXL04_022480
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 61.111 / OH-1004 30.662 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G449640

Location Chr02:114382757-114383679 (+)

Description Similar to RPI3: Probable ribose-5-phosphate isomerase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04790`	Catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate.	No verified direct reference in this release
`At2g01290`	Catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate.	Deficiency in a cytosolic ribose-5-phosphate isomerase causes chloroplast dysfunction, late flowering and premature cell death in Arabidopsis.2009 · DOI: 10.1111/j.1399-3054.2009.01276.x
`At1g71100`	Catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022480 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009052 pentose-phosphate shunt, non-oxidative branch Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0019253 reductive pentose-phosphate cycle Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0046109 uridine biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT1G71100

ath:AT2G01290

ath:AT3G04790

dal:Dalk_2973

pfa:PF3D7_0514600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.959

Rank 1 · TkA02G449640 · TK1151

Mitochondrion0.044

Rank 2 · TkA02G449640 · TK1151

Nucleus0.025

Rank 3 · TkA02G449640 · TK1151

Cytoplasm0.021

Rank 4 · TkA02G449640 · TK1151

Cell membrane0.011

Rank 5 · TkA02G449640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25912DUF796450-95 aa

PF00455DeoRC58-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G449640	`PF25912`	DUF7964	50	95	0.056	14.8
TkA02G449640	`PF00455`	DeoRC	58	88	0.059	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S726`	Arabidopsis thaliana	sp\|Q9S726\|RPI3_ARATH Probable ribose-5-phosphate isomerase 3, chloroplastic	60.700%	Swiss-Prot	Low
`Q9ZU38`	Arabidopsis thaliana	sp\|Q9ZU38\|RPI2_ARATH Probable ribose-5-phosphate isomerase 2	68.800%	Swiss-Prot	Low
`Q9C998`	Arabidopsis thaliana	sp\|Q9C998\|RPI1_ARATH Probable ribose-5-phosphate isomerase 1	72.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card