TkA02G449300 | RubberDandelionOmics

Gene overview

TkA02G449300

Reference: TK1151 Chr: Chr02 Coordinates: 114291676-114292101 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

426 bp · TkA02G449300|TK1151|cDNA

ATGCACTCATCCAAAATTTGGGGTATGGAGAAATTAGAAATGATTGACCTTGAAGGAAATTTGATTCACGGGAGCTTACAGTCTCACTTCAGTGGTCTTAAAAACCTCCGAGTTCTCAATTTGGGGTTTAATCAGATTTCCGGAGAGATACCAAATTCAATATCCCAATTCAAGAACCTACAGGTCTTGAATCTCGCAGGCAATCACATCAACGGTTCAATTCCAAGATTTCTCGACAATTTTGGGGATTTACGAGGATT...

CDS

Download CDS FASTA

426 bp · TkA02G449300|TK1151|CDS

ATGCACTCATCCAAAATTTGGGGTATGGAGAAATTAGAAATGATTGACCTTGAAGGAAATTTGATTCACGGGAGCTTACAGTCTCACTTCAGTGGTCTTAAAAACCTCCGAGTTCTCAATTTGGGGTTTAATCAGATTTCCGGAGAGATACCAAATTCAATATCCCAATTCAAGAACCTACAGGTCTTGAATCTCGCAGGCAATCACATCAACGGTTCAATTCCAAGATTTCTCGACAATTTTGGGGATTTACGAGGATT...

Protein

Download Protein FASTA

141 aa · TkA02G449300|TK1151|PROTEIN

MHSSKIWGMEKLEMIDLEGNLIHGSLQSHFSGLKNLRVLNLGFNQISGEIPNSISQFKNLQVLNLAGNHINGSIPRFLDNFGDLRGLYLSFNQLSRNIPIEIGYKSDFRGQLLQRYDPLSNHHSPKSKTFMGNYIEQMASY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G449300`
TK1151 ID	TkA02G449300
OH-1004 ID	LXL04_014163
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G449300`
Location	Chr02:114291676-114292101 (-)
Description	Similar to RPK2: LRR receptor-like serine/threonine-protein kinase RPK2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014163` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009808 lignin metabolic process Biological Process GO:0009846 pollen germination Biological Process GO:0009942 longitudinal axis specification Biological Process GO:0009945 radial axis specification Biological Process GO:0010073 meristem maintenance Biological Process GO:0010152 pollen maturation Biological Process GO:0048508 embryonic meristem development Biological Process GO:0048653 anther development Biological Process GO:0005886 plasma membrane Cellular Component GO:0004674 protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference	ath:AT1G17230 ath:AT3G02130 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.340

Rank 1 · TkA02G449300 · TK1151

Extracellular0.187

Rank 2 · TkA02G449300 · TK1151

Endoplasmic reticulum0.150

Rank 3 · TkA02G449300 · TK1151

Cytoplasm0.135

Rank 4 · TkA02G449300 · TK1151

Nucleus0.128

Rank 5 · TkA02G449300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855LRR_86-22 aa

PF24758LRR_At5g563709-71 aa

PF12799LRR_411-47 aa

PF13855LRR_811-70 aa

PF00560LRR_111-33 aa

PF29594LRR_SKP211-93 aa

PF13516LRR_612-20 aa

PF23598LRR_1412-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G449300	`PF13855`	LRR_8	6	22	3e-16	59.6
TkA02G449300	`PF24758`	LRR_At5g56370	9	71	0.12	12.7
TkA02G449300	`PF12799`	LRR_4	11	47	6.8e-17	61.8
TkA02G449300	`PF13855`	LRR_8	11	70	3e-16	59.6
TkA02G449300	`PF00560`	LRR_1	11	33	1.2e-13	49.0
TkA02G449300	`PF29594`	LRR_SKP2	11	93	0.0007	19.7
TkA02G449300	`PF13516`	LRR_6	12	20	1.7e-05	25.2
TkA02G449300	`PF23598`	LRR_14	12	90	7.4e-05	22.4
TkA02G449300	`PF25372`	LRR_FBXL15	17	71	0.027	13.6
TkA02G449300	`PF12799`	LRR_4	34	74	6.8e-17	61.8
TkA02G449300	`PF13516`	LRR_6	34	49	1.7e-05	25.2
TkA02G449300	`PF00560`	LRR_1	35	56	1.2e-13	49.0
TkA02G449300	`PF13855`	LRR_8	54	94	3e-16	59.6
TkA02G449300	`PF12799`	LRR_4	58	96	6.8e-17	61.8
TkA02G449300	`PF00560`	LRR_1	59	80	1.2e-13	49.0
TkA02G449300	`PF13516`	LRR_6	59	72	1.7e-05	25.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card