RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G449290
Reference: TK1151 Chr: Chr02 Coordinates: 114279977-114283860 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3670 bp · TkA02G449290|TK1151|cDNA

TTGTTTCCTCTGTCGATTTATGTTCATTTTGGGGCGTAGAATATTACATCTGGTGGCATAATTTGGAAAGCCAGCTTTTGAATCCCTAACTAAGCTTAAAAAGCTTCGACAAGATGGGGAAGATTGCTGGTTTCAATGGGTGATTTCGAGTTTCTTTCATAGAGTTTCTGTACCCACATAACCCTTAGCTCTACTTTCGACTTCAACCCCCCAAAAAGGCAGTATGCGAATGCAACTGCTTCTCTTGTTCTTGTGGGTCG...

CDS

Download CDS FASTA

3129 bp · TkA02G449290|TK1151|CDS

ATGCGAATGCAACTGCTTCTCTTGTTCTTGTGGGTCGTCGCCGCCGCCGGAGCCACATCTCCGGACGAAGTCCGGGCATTGTTCGAGTTCAAGAAAGGGATCAGTGAAGATCCCCTCAGAAAAGTCTACGATTCGTGGAACATTTCCAGCTCGGATCCAGCTTCCATTTGCCCCCAATTTTATGGCATTTCCTGCGACGAAAACGGGTTTGTTTCCGCCATTGTTCTTGACCAACTTGACTTGGCCGGAGAACTCAAATT...

Protein

Download Protein FASTA

1042 aa · TkA02G449290|TK1151|PROTEIN

MRMQLLLLFLWVVAAAGATSPDEVRALFEFKKGISEDPLRKVYDSWNISSSDPASICPQFYGISCDENGFVSAIVLDQLDLAGELKFFTLYSLKMLRNLSLSGNRLSGRLVPSLGSMYSLQYLDLSGNQFYGPIPARINDLYGLNYLNLSNNNFTGGFPTGIRNLQQLMVLDLHSNSLWGDIGVMFSELRNVQHVDLSDNSFYGSLSNVANNSSAVNTLQHVNLSRNRLGGGFFTGDSLVLFRNLHVLDLGDNELNGKLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G449290
TK1151 IDTkA02G449290
OH-1004 IDLXL04_014166
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G449290
LocationChr02:114279977-114283860 (-)
DescriptionSimilar to At5g10020: Probable inactive receptor kinase At5g10020
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g10020 Probable inactive receptor kinase At5g10020. No verified direct reference in this release
At4g20940 Receptor kinase acting as an early component in abscisic acid (ABA) signaling.
A plasma membrane receptor kinase, GHR1, mediates abscisic acid- and hydrogen peroxide-regulated stomatal movement in Arabidopsis.2012 · DOI: 10.1105/tpc.112.100107
A Dominant Mutation in the HT1 Kinase Uncovers Roles of MAP Kinases and GHR1 in CO2-Induced Stomatal Closure.2016 · DOI: 10.1105/tpc.16.00131
Coordinating the overall stomatal response of plants: Rapid leaf-to-leaf communication during light stress.2018 · DOI: 10.1126/scisignal.aam9514
The Receptor-like Pseudokinase GHR1 Is Required for Stomatal Closure.2018 · DOI: 10.1105/tpc.18.00441
At3g56100 Can phosphorylate AGL24. No verified direct reference in this release
At3g51740 Probably inactive leucine-rich repeat receptor-like protein kinase IMK2. No verified direct reference in this release
At2g26730 Probable inactive receptor kinase At2g26730. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_014166 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0007165 signal transduction Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009745 sucrose mediated signaling Biological Process
GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process
GO:0010067 procambium histogenesis Biological Process
GO:0010087 phloem or xylem histogenesis Biological Process
GO:0030154 cell differentiation Biological Process
GO:0071244 cellular response to carbon dioxide Biological Process
GO:0071485 cellular response to absence of light Biological Process
KEGG gene cross-reference
ath:AT1G08590
ath:AT4G20940
ath:AT5G10020
gmx:732625
mtr:11439632
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.861
Rank 1 · TkA02G449290 · TK1151
Endoplasmic reticulum0.078
Rank 2 · TkA02G449290 · TK1151
Cytoplasm0.068
Rank 3 · TkA02G449290 · TK1151
Nucleus0.056
Rank 4 · TkA02G449290 · TK1151
Lysosome / Vacuole0.025
Rank 5 · TkA02G449290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_221-66 aa
PF25013LRR_Zer-177-128 aa
PF29247LRR_MHP1-HER1-GIP384-129 aa
PF13855LRR_889-130 aa
PF23598LRR_1489-204 aa
PF24758LRR_At5g5637089-152 aa
PF25019LRR_R13L1-DRL2192-126 aa
PF29594LRR_SKP293-226 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G449290PF08263LRRNT_221663.3e-0628.0
TkA02G449290PF25013LRR_Zer-1771280.004417.9
TkA02G449290PF29247LRR_MHP1-HER1-GIP3841294.07.3
TkA02G449290PF13855LRR_8891301.4e-2176.7
TkA02G449290PF23598LRR_14892049.4e-1864.8
TkA02G449290PF24758LRR_At5g56370891520.0009519.6
TkA02G449290PF25019LRR_R13L1-DRL21921260.2212.2
TkA02G449290PF29594LRR_SKP2932260.003217.5
TkA02G449290PF13516LRR_6941073.6e-0833.6
TkA02G449290PF12799LRR_4951298.4e-30102.8
TkA02G449290PF00560LRR_1961171.6e-38123.0
TkA02G449290PF23211LRR_LRWD1961770.1312.7
TkA02G449290PF24141LRR_ComC971350.001319.1
TkA02G449290PF29265LRR_CARMIL981302.37.5
TkA02G449290PF00560LRR_11191391.6e-38123.0
TkA02G449290PF13516LRR_61191293.6e-0833.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q0WR59Arabidopsis thalianasp|Q0WR59|Y5020_ARATH Probable inactive receptor kinase At5g1002058.100%Swiss-ProtHigh
C0LGQ9Arabidopsis thalianasp|C0LGQ9|GHR1_ARATH LRR receptor-like serine/threonine-protein kinase GHR155.800%Swiss-ProtLow
C0LGP9Arabidopsis thalianasp|C0LGP9|IMK3_ARATH Probable leucine-rich repeat receptor-like protein kinase IMK339.900%Swiss-ProtLow
Q9SCT4Arabidopsis thalianasp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK238.600%Swiss-ProtLow
O48788Arabidopsis thalianasp|O48788|Y2267_ARATH Probable inactive receptor kinase At2g2673033.200%Swiss-ProtLow

JBrowse

View in Genome Browser