TkA02G448510 | RubberDandelionOmics

Gene overview

TkA02G448510

Reference: TK1151 Chr: Chr02 Coordinates: 114063745-114066199 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

726 bp · TkA02G448510|TK1151|cDNA

ATGCTTCCATTCACGCCCTTTTACTTCCCAAGCTGTTCACGCCCTTTAGGTTCAAAGCTGTTCACGCCCTTTTACTTCCCAAGCTGTTCACGCCCTTTTGGTTCAGAGCTGTTCACGCCCTTTAACTCCAAACCCAATCACACCCTTTTTCTTCAAAGGCTGTTCACTCCTTTTGCTTCCAAGGCTATTCACGCCTTTCTAAGGGAAACTCGAAGCAATCTGTTTCCATTTGATCTCAAGTTCTCAACAGTCCACACTCG...

CDS

Download CDS FASTA

726 bp · TkA02G448510|TK1151|CDS

ATGCTTCCATTCACGCCCTTTTACTTCCCAAGCTGTTCACGCCCTTTAGGTTCAAAGCTGTTCACGCCCTTTTACTTCCCAAGCTGTTCACGCCCTTTTGGTTCAGAGCTGTTCACGCCCTTTAACTCCAAACCCAATCACACCCTTTTTCTTCAAAGGCTGTTCACTCCTTTTGCTTCCAAGGCTATTCACGCCTTTCTAAGGGAAACTCGAAGCAATCTGTTTCCATTTGATCTCAAGTTCTCAACAGTCCACACTCG...

Protein

Download Protein FASTA

241 aa · TkA02G448510|TK1151|PROTEIN

MLPFTPFYFPSCSRPLGSKLFTPFYFPSCSRPFGSELFTPFNSKPNHTLFLQRLFTPFASKAIHAFLRETRSNLFPFDLKFSTVHTRTVELFISLLLGSLASIRFLAPTSILEFQNARFFEHSDCRLPSSKRAFIWDFRDLMIEEDDLLLTFLKDRELNGDFIAKVTDKLWMRKTINIDNIETDLRSDDSERRTRLNLLQYEAVLELAGNAARDNKKTRIVPRHIQLADRNDEDKLFFVIN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G448510`
TK1151 ID	TkA02G448510
OH-1004 ID	LXL04_015214
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.400
Protein coverage (%)	TK1151 26.971 / OH-1004 34.591 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G448510

Location Chr02:114063745-114066199 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54640`	Core component of nucleosome.	An Arabidopsis histone H2A mutant is deficient in Agrobacterium T-DNA integration.2000 · DOI: 10.1073/pnas.97.2.948 Expression of the Arabidopsis histone H2A-1 gene correlates with susceptibility to Agrobacterium transformation.2002 · DOI: 10.1046/j.1365-313x.2002.01425.x
`At4g27230`	Core component of nucleosome.	No verified direct reference in this release
`At1g51060`	Core component of nucleosome.	No verified direct reference in this release
`At3g20670`	Core component of nucleosome.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YVE5`	Core component of nucleosome.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015214 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.361

Rank 1 · TkA02G448510 · TK1151

Nucleus0.317

Rank 2 · TkA02G448510 · TK1151

Mitochondrion0.214

Rank 3 · TkA02G448510 · TK1151

Plastid0.069

Rank 4 · TkA02G448510 · TK1151

Cell membrane0.065

Rank 5 · TkA02G448510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00125Histone52-80 aa

PF00125Histone203-230 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G448510	`PF00125`	Histone	52	80	0.0017	19.4
TkA02G448510	`PF00125`	Histone	203	230	0.0017	19.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LD28`	Arabidopsis thaliana	sp\|Q9LD28\|H2A6_ARATH Histone H2A.6	82.100%	Swiss-Prot	Low
`O81826`	Arabidopsis thaliana	sp\|O81826\|H2A3_ARATH Probable histone H2A.3	82.100%	Swiss-Prot	Low
`Q9C681`	Arabidopsis thaliana	sp\|Q9C681\|H2A1_ARATH Probable histone H2A.1	82.100%	Swiss-Prot	Low
`Q9LHQ5`	Arabidopsis thaliana	sp\|Q9LHQ5\|H2A2_ARATH Probable histone H2A.2	82.100%	Swiss-Prot	Low
`A2YVE5`	Oryza sativa subsp. indica	sp\|A2YVE5\|H2A3_ORYSI Probable histone H2A.3	82.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card