TkA02G448470 | RubberDandelionOmics

Gene overview

TkA02G448470

Reference: TK1151 Chr: Chr02 Coordinates: 114051143-114053950 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1522 bp · TkA02G448470|TK1151|cDNA

GGGACCTCTTGCGTACCTTTTGTAATTCGGTTCCTTTGACGATTGAAACGCGAATGTCTACTCATTAATATAAACGGAGCGAGTTTTGGATTAGGGTTTCTTTCTGAACCCAAAGAGCGAGGCTTCTCTTTCATACAGACCAAGGAAGAGGGCTTCAACAGTGTGTCGTGCGGCAATCTTTTCGATTATTTTTCCGATACATATCATAACAATGGCAACAGCAGCAGCGCCATCTCGTTCCTTCTTGCAAGTGGCAGCCA...

CDS

Download CDS FASTA

1023 bp · TkA02G448470|TK1151|CDS

ATGGCAACAGCAGCAGCGCCATCTCGTTCCTTCTTGCAAGTGGCAGCCACTGAAGAGGCAGTTGCTCCGCCTTTAAGAGTTGTCCAGATCGAAGGACTGGTTATATTGAAGATCATCAAACACTGCACAGAGTTTTCACCTGCTCTTGTGACTGGTCAACTTCTCGGCTTAGATGTTGGCAGTGTTCTTGAAGTAACCAACTGCTTCCCATTTCCTATCAGGGAGGAAGACGAGGAGATTGAGGCAGAGGGTGCTAACTA...

Protein

Download Protein FASTA

340 aa · TkA02G448470|TK1151|PROTEIN

MATAAAPSRSFLQVAATEEAVAPPLRVVQIEGLVILKIIKHCTEFSPALVTGQLLGLDVGSVLEVTNCFPFPIREEDEEIEAEGANYQLEMMRCLREVNVDNNTVGWYQSTLLGSFQTVELIETFMNYQENIRRCVCIIYDPSKSNQGVLALKALKLSDSFMELYRSNEFNGEKLREKNLSWVDIFEEIPIKVSNSALVSAFMTELEADSPVTQSDYDRLQLSTNPFMERNMEFLIECMDDLSMEQQKFQFYYRNLSRQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G448470`
TK1151 ID	TkA02G448470
OH-1004 ID	LXL04_014195
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G448470

Location Chr02:114051143-114053950 (-)

Description Similar to TIF3H1: Eukaryotic translation initiation factor 3 subunit H

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10840`	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014195 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001732 formation of cytoplasmic translation initiation complex Biological Process

GO:0006413 translational initiation Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0034286 response to maltose Biological Process

GO:0045948 positive regulation of translational initiation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005840 ribosome Cellular Component

KEGG gene cross-reference

ath:AT1G10840

ddi:DDB_G0281153

nve:5511049

xla:496043

xtr:394989

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.534

Rank 1 · TkA02G448470 · TK1151

Nucleus0.445

Rank 2 · TkA02G448470 · TK1151

Golgi apparatus0.064

Rank 3 · TkA02G448470 · TK1151

Lysosome / Vacuole0.063

Rank 4 · TkA02G448470 · TK1151

Cell membrane0.052

Rank 5 · TkA02G448470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01398JAB26-130 aa

PF17589DUF5487126-152 aa

PF19445eIF3h_C146-339 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G448470	`PF01398`	JAB	26	130	5.5e-17	62.4
TkA02G448470	`PF17589`	DUF5487	126	152	0.11	13.4
TkA02G448470	`PF19445`	eIF3h_C	146	339	6.9e-57	193.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5Z2`	Arabidopsis thaliana	sp\|Q9C5Z2\|EIF3H_ARATH Eukaryotic translation initiation factor 3 subunit H	85.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card