Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3292 bp · TkA02G447840|TK1151|cDNA
TGTTTTTTTGTATTTTTTCTATCTAGTACCATGCTCCATTAGCTAATGATATTCTACCCAAAAAAAGGTTTATGATAATAAGATGTAGCTCAGTGCTAAAACACCGCGTGGATTGCTGAGTGCCGTTGCTCTCAACGGTGTTGGTGGCGGAGTGCGGTTGTTCTCCTCCTTGTTGGTGTTGGGTTGGGGCCTTGGGGGTTGCGATACTCCAACCGTCCACCGTGGTCTGCGAGGTCCCGATTAGACCATGATTTGTCGCT...
2139 bp · TkA02G447840|TK1151|CDS
ATGTTCGTTGAAGCTACGACTTCAATTGTGAATTTCTCCCCATGTTTTGGTTTGAAGTCAGCATACAATCATCGGACATCTCGAGTTTCAATTAGGTGCTCTGGTACAGCAGCAGATCCATCTCTCGTGGAGACCCCCGATTCATTTAAAGTAAATGGAGTTTCTTCTAATAACAGAGTTAGGTCTCTGAATGGTGTTGAAAAGAAGGAGTTACTTGTTTCAGATGCTACTAACGACAAAAGTAAATGGAACGAAGAAAA...
Protein
Download Protein FASTA712 aa · TkA02G447840|TK1151|PROTEIN
MFVEATTSIVNFSPCFGLKSAYNHRTSRVSIRCSGTAADPSLVETPDSFKVNGVSSNNRVRSLNGVEKKELLVSDATNDKSKWNEEKLEPLWDDGYGTQSVKDYLDIAKDIIKPDGGPPRWFCPVFADGNDSPLPNSPVLLFLPGMDGLGLGLILHHKALRKVFEVRCLHIPVQDRTPFEDLVTFVEGTLRFEHALFPSRPIYIVGDSFGGCLALAVAARNPSIDLVVILSNPATSFDRSQLQPVLPVLEAMPDTLHGTI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G447840 |
|---|---|
| TK1151 ID | TkA02G447840 |
| OH-1004 ID | LXL04_003765 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 53.500 |
| Protein coverage (%) | TK1151 99.298 / OH-1004 99.549Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G447840 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:113879223-113883661 (+) | |||||||||
| Description | Similar to At1g54570: Acyltransferase-like protein At1g54570, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006995 cellular response to nitrogen starvation Biological Process GO:0010150 leaf senescence Biological Process GO:0010866 regulation of triglyceride biosynthetic process Biological Process GO:0019432 triglyceride biosynthetic process Biological Process GO:0033306 phytol metabolic process Biological Process GO:0090693 plant organ senescence Biological Process GO:1904963 regulation of phytol biosynthetic process Biological Process GO:0009507 chloroplast Cellular Component GO:0010287 plastoglobule Cellular Component GO:0016020 membrane Cellular Component GO:0004144 diacylglycerol O-acyltransferase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G54570 ath:AT3G26840 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00561Abhydrolase_1175-380 aaPF12697Abhydrolase_6177-381 aaPF00326Peptidase_S9178-237 aaPF12146Hydrolase_4180-380 aaPF07859Abhydrolase_3199-222 aaPF08840BAAT_C201-241 aaPF01738DLH202-229 aaPF00326Peptidase_S9330-377 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G447840 | PF00561 | Abhydrolase_1 | 175 | 380 | 2.9e-06 | 27.8 |
| TkA02G447840 | PF12697 | Abhydrolase_6 | 177 | 381 | 8.1e-05 | 24.1 |
| TkA02G447840 | PF00326 | Peptidase_S9 | 178 | 237 | 0.021 | 15.1 |
| TkA02G447840 | PF12146 | Hydrolase_4 | 180 | 380 | 1.1e-09 | 38.7 |
| TkA02G447840 | PF07859 | Abhydrolase_3 | 199 | 222 | 0.12 | 12.8 |
| TkA02G447840 | PF08840 | BAAT_C | 201 | 241 | 0.001 | 19.8 |
| TkA02G447840 | PF01738 | DLH | 202 | 229 | 0.26 | 11.6 |
| TkA02G447840 | PF00326 | Peptidase_S9 | 330 | 377 | 0.021 | 15.1 |
| TkA02G447840 | PF08386 | Abhydrolase_4 | 332 | 378 | 0.19 | 12.6 |
| TkA02G447840 | PF01738 | DLH | 332 | 377 | 0.26 | 11.6 |
| TkA02G447840 | PF08840 | BAAT_C | 334 | 377 | 0.001 | 19.8 |
| TkA02G447840 | PF07859 | Abhydrolase_3 | 336 | 376 | 0.12 | 12.8 |
| TkA02G447840 | PF03982 | DAGAT | 532 | 602 | 8.6e-06 | 25.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.