TkA02G447790 | RubberDandelionOmics

Gene overview

TkA02G447790

Reference: TK1151 Chr: Chr02 Coordinates: 113870692-113872653 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

992 bp · TkA02G447790|TK1151|cDNA

GTGATCAGATTTGATGACTTGCTGTTTCCGTTCACGGCAATACACTCTTTGTAGGAAAAGAACCGGTTGTAAATGAATAAACACAAAATCAAAATTCCCAAAAATCTGGTTTAAAAGGAGATCAGATTCACAAGTGGACCGACTTCCTCCTTCCCATTCCCTCCACGTATCTCTTTCTCTCACGTTATCTTTCCAATTCATCATCATCTGTACGTTCGTTATAATCAAACCCATTAACGCCAACTCACCTTTCCTGAAAC...

CDS

Download CDS FASTA

561 bp · TkA02G447790|TK1151|CDS

ATGGAAGACGCTAACGTTGTTGAAGCTAAAGATGGAGCCATCGCTGTTGCCTCTGCTTTTGCTGGCCACCAGGAAGTTGTGAAGGATCGAGACCACAAATTCCTGACAAGAGCTGTTGAAGAAGCTTACAAAGGAGTTGATTGTGGAGATGGAGGCCCATTTGGGGCTGTTGTGGTTCGTAACGATGAAGTTGTTGTGAGTTGCCATAACATGGTTCTAAAACACACCGATCCAACTGCACATGCTGAAGTCACAGCAAT...

Protein

Download Protein FASTA

186 aa · TkA02G447790|TK1151|PROTEIN

MEDANVVEAKDGAIAVASAFAGHQEVVKDRDHKFLTRAVEEAYKGVDCGDGGPFGAVVVRNDEVVVSCHNMVLKHTDPTAHAEVTAIREACKKLNQIELSDCEIYASCEPCPMCFGAIHLSRIKRLVYGAKAEAAIAIGFDDFIADALRGTGFYQKANLEIKKADGNGAMIAEQVFEKTKAKFAMY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G447790`
TK1151 ID	TkA02G447790
OH-1004 ID	LXL04_014200
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 97.895 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G447790

Location Chr02:113870692-113872653 (-)

Description Similar to GSDA: Guanosine deaminase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28050`	Catalyzes the hydrolytic deamination of guanosine, producing xanthosine and ammonia.	Plant purine nucleoside catabolism employs a guanosine deaminase required for the generation of xanthosine in Arabidopsis.2013 · DOI: 10.1105/tpc.113.117184

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014200 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002100 tRNA wobble adenosine to inosine editing Biological Process

GO:0006147 guanine catabolic process Biological Process

GO:0006152 purine nucleoside catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0008892 guanine deaminase activity Molecular Function

GO:0047974 guanosine deaminase activity Molecular Function

GO:0052717 tRNA-specific adenosine-34 deaminase activity Molecular Function

KEGG gene cross-reference

aae:aq_903

ath:AT5G28050

bsu:BSU00180

bsu:BSU13170

sav:SAV0558

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.552

Rank 1 · TkA02G447790 · TK1151

Nucleus0.481

Rank 2 · TkA02G447790 · TK1151

Cell membrane0.140

Rank 3 · TkA02G447790 · TK1151

Endoplasmic reticulum0.067

Rank 4 · TkA02G447790 · TK1151

Mitochondrion0.051

Rank 5 · TkA02G447790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04475DUF5557-103 aa

PF00383dCMP_cyt_deam_130-129 aa

PF14437MafB19-deam34-178 aa

PF18782APOBEC361-118 aa

PF04475DUF55572-115 aa

PF15193FAM2475-118 aa

PF09930DUF2162104-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G447790	`PF04475`	DUF555	7	103	0.31	12.0
TkA02G447790	`PF00383`	dCMP_cyt_deam_1	30	129	8.4e-28	97.0
TkA02G447790	`PF14437`	MafB19-deam	34	178	3.1e-21	76.4
TkA02G447790	`PF18782`	APOBEC3	61	118	0.03	15.2
TkA02G447790	`PF04475`	DUF555	72	115	0.31	12.0
TkA02G447790	`PF15193`	FAM24	75	118	0.16	13.5
TkA02G447790	`PF09930`	DUF2162	104	122	0.095	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94BU8`	Arabidopsis thaliana	sp\|Q94BU8\|GSDA_ARATH Guanosine deaminase	84.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card