TkA02G440580 | RubberDandelionOmics

Gene overview

TkA02G440580

Reference: TK1151 Chr: Chr02 Coordinates: 111966082-111966949 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

732 bp · TkA02G440580|TK1151|cDNA

ATGGGCCATCACTGCTGCAGCAAACAGAAAGTTAAGAGAGGTTTATGGTCTCCTGAAGAAGATGAAAAACTCATCAAACACATCACCGCCCATGGCCATGGCTGCTGGAGTTCTGTCCCTAAACTTGCAGGGCTTCAAAGATGTGGAAAGAGTTGCAGATTAAGGTGGATAAACTACTTGAGACCCGATTTAAGGCGAGGTTCATTTACCGAACAAGAAGAGAGAACGATCATTGATGTTCATAGGATACTGGGAAACAG...

CDS

Download CDS FASTA

732 bp · TkA02G440580|TK1151|CDS

ATGGGCCATCACTGCTGCAGCAAACAGAAAGTTAAGAGAGGTTTATGGTCTCCTGAAGAAGATGAAAAACTCATCAAACACATCACCGCCCATGGCCATGGCTGCTGGAGTTCTGTCCCTAAACTTGCAGGGCTTCAAAGATGTGGAAAGAGTTGCAGATTAAGGTGGATAAACTACTTGAGACCCGATTTAAGGCGAGGTTCATTTACCGAACAAGAAGAGAGAACGATCATTGATGTTCATAGGATACTGGGAAACAG...

Protein

Download Protein FASTA

243 aa · TkA02G440580|TK1151|PROTEIN

MGHHCCSKQKVKRGLWSPEEDEKLIKHITAHGHGCWSSVPKLAGLQRCGKSCRLRWINYLRPDLRRGSFTEQEERTIIDVHRILGNRWAQIAKHLPGRTDNEVKNFWNSCIKKKLIAQGLDPNTHNLLSAHQIPILNVNNSKHSDPTKPVFSIINNTSSQTKDSKRFNSLRPHFTTLIDTNNDHVMSHNLNENSLTHQNSNLNYQDYNLISTQPLVENTKMPIFLPLPSSLNPLDFGGQNLVW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G440580`
TK1151 ID	TkA02G440580
OH-1004 ID	LXL04_008266
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	79.500
Protein coverage (%)	TK1151 54.321 / OH-1004 34.916 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G440580

Location Chr02:111966082-111966949 (-)

Description Similar to MYB26: Transcription factor MYB26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26660`	Probable transcription factor.	No verified direct reference in this release
`At1g09540`	Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation.	AtMYB61, an R2R3-MYB transcription factor controlling stomatal aperture in Arabidopsis thaliana.2005 · DOI: 10.1016/j.cub.2005.06.041 MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana.2009 · DOI: 10.1093/jxb/erp102 AtMYB61, an R2R3-MYB transcription factor, functions as a pleiotropic regulator via a small gene network.2012 · DOI: 10.1111/j.1469-8137.2012.04201.x Interactions between the R2R3-MYB transcription factor, AtMYB61, and target DNA binding sites.2013 · DOI: 10.1371/journal.pone.0065132 AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.2017 · DOI: 10.1111/tpj.13509
`At3g13890`	Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence.	Disruption of Arabidopsis thaliana MYB26 results in male sterility due to non-dehiscent anthers.2003 · DOI: 10.1046/j.1365-313x.2003.01745.x Efficient production of male and female sterile plants by expression of a chimeric repressor in Arabidopsis and rice.2006 · DOI: 10.1111/j.1467-7652.2006.00184.x Arabidopsis MYB26/MALE STERILE35 regulates secondary thickening in the endothecium and is essential for anther dehiscence.2007 · DOI: 10.1105/tpc.106.046391

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008266 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010089 xylem development Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010214 seed coat development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1901348 positive regulation of secondary cell wall biogenesis Biological Process

KEGG gene cross-reference

ath:AT1G09540

ath:AT3G13890

ath:AT5G12870

ath:AT5G26660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.778

Rank 1 · TkA02G440580 · TK1151

Cytoplasm0.306

Rank 2 · TkA02G440580 · TK1151

Mitochondrion0.036

Rank 3 · TkA02G440580 · TK1151

Cell membrane0.017

Rank 4 · TkA02G440580 · TK1151

Lysosome / Vacuole0.010

Rank 5 · TkA02G440580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding13-60 aa

PF13921Myb_DNA-bind_616-75 aa

PF23588HTH_CHD1_Hrp316-39 aa

PF05649Peptidase_M13_N64-131 aa

PF00249Myb_DNA-binding66-109 aa

PF13921Myb_DNA-bind_669-113 aa

PF10933DUF2827131-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G440580	`PF00249`	Myb_DNA-binding	13	60	1e-35	122.3
TkA02G440580	`PF13921`	Myb_DNA-bind_6	16	75	6.4e-20	71.8
TkA02G440580	`PF23588`	HTH_CHD1_Hrp3	16	39	0.0047	17.6
TkA02G440580	`PF05649`	Peptidase_M13_N	64	131	0.064	13.4
TkA02G440580	`PF00249`	Myb_DNA-binding	66	109	1e-35	122.3
TkA02G440580	`PF13921`	Myb_DNA-bind_6	69	113	6.4e-20	71.8
TkA02G440580	`PF10933`	DUF2827	131	216	0.1	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPH6`	Arabidopsis thaliana	sp\|Q8LPH6\|MYB86_ARATH Transcription factor MYB86	66.500%	Swiss-Prot	Medium
`Q8VZQ2`	Arabidopsis thaliana	sp\|Q8VZQ2\|MYB61_ARATH Transcription factor MYB61	73.800%	Swiss-Prot	Medium
`Q9SPG3`	Arabidopsis thaliana	sp\|Q9SPG3\|MYB26_ARATH Transcription factor MYB26	78.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card