Gene Card
Gene overview
cDNA / CDS / Protein Sequences
489 bp · TkA02G439800|TK1151|cDNA
ATGATATGCCCCCTTAATCCCTTATGCATCCCGTTTCTCTATCATCATTCCTCAATATTTCGAGATTGTGAAAACCCCGCTCAATCGCCCCAAAATTCTAAGAACGTAAAAGAAACCCTCGCTCAATCCCACACTTACCCTCGCTCCGCTCCAGTTCTCTTGCAGTCTCGCTCAATCCGTTTCTCGATACCCTGTACCAAGTCATTTAGGGTTCATCTGACTTCGCACTGTCGACTTCTACACGAAGGCGTTAGGGTTTG...
489 bp · TkA02G439800|TK1151|CDS
ATGATATGCCCCCTTAATCCCTTATGCATCCCGTTTCTCTATCATCATTCCTCAATATTTCGAGATTGTGAAAACCCCGCTCAATCGCCCCAAAATTCTAAGAACGTAAAAGAAACCCTCGCTCAATCCCACACTTACCCTCGCTCCGCTCCAGTTCTCTTGCAGTCTCGCTCAATCCGTTTCTCGATACCCTGTACCAAGTCATTTAGGGTTCATCTGACTTCGCACTGTCGACTTCTACACGAAGGCGTTAGGGTTTG...
Protein
Download Protein FASTA162 aa · TkA02G439800|TK1151|PROTEIN
MICPLNPLCIPFLYHHSSIFRDCENPAQSPQNSKNVKETLAQSHTYPRSAPVLLQSRSIRFSIPCTKSFRVHLTSHCRLLHEGVRVCVDLNALRFSSSPLLFSSDSIPFSSPQSIFKFARNRGCDGPFRHLGSIYDPCVCHHCVLWVCVRRLWTSAARVSQI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G439800 |
|---|---|
| TK1151 ID | TkA02G439800 |
| OH-1004 ID | LXL04_016215 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 39.400 |
| Protein coverage (%) | TK1151 58.025 / OH-1004 21.905Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G439800 |
|---|---|
| Location | Chr02:111746125-111746613 (+) |
| Description | Similar to AATL1: Lysine histidine transporter-like 8 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0003333 amino acid transmembrane transport Biological Process GO:0006152 purine nucleoside catabolic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009536 plastid Cellular Component GO:0016020 membrane Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0015171 amino acid transmembrane transporter activity Molecular Function GO:0047974 guanosine deaminase activity Molecular Function |
| KEGG gene cross-reference | ath:AT1G47670 ath:AT5G28050 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.