TkA02G438440 | RubberDandelionOmics

Gene overview

TkA02G438440

Reference: TK1151 Chr: Chr02 Coordinates: 111386295-111387963 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · TkA02G438440|TK1151|cDNA

ATGTATTTTGATTTTGTTAGGTTACTTCATTTGGAGCCACATTGCGCGAAGCACCGTAAGTCTTCGATTGTAGAATCAAAAGATGTGTTGCTACACTTAGGGCTTATTAAAGACTTGGAGGATGAACCTGAAGATGAGATTATTTTGACTGTGAGGTCCAAAGCGTCTTCATTTCACAATTCCTCCTCTTGTCTTTTCAGCTTTAAGTTGGTTAGGCAATTACAAAATCAAGATGGAGATGTGGCTGGAGAAGAGGATCC...

CDS

Download CDS FASTA

588 bp · TkA02G438440|TK1151|CDS

ATGTATTTTGATTTTGTTAGGTTACTTCATTTGGAGCCACATTGCGCGAAGCACCGTAAGTCTTCGATTGTAGAATCAAAAGATGTGTTGCTACACTTAGGGCTTATTAAAGACTTGGAGGATGAACCTGAAGATGAGATTATTTTGACTGTGAGGTCCAAAGCGTCTTCATTTCACAATTCCTCCTCTTGTCTTTTCAGCTTTAAGTTGGTTAGGCAATTACAAAATCAAGATGGAGATGTGGCTGGAGAAGAGGATCC...

Protein

Download Protein FASTA

195 aa · TkA02G438440|TK1151|PROTEIN

MYFDFVRLLHLEPHCAKHRKSSIVESKDVLLHLGLIKDLEDEPEDEIILTVRSKASSFHNSSSCLFSFKLVRQLQNQDGDVAGEEDPTTPPKKIFQLLNQTIEVLSYVPAPELALRLYLQYAEAANDRDLEPVAYEFFTKEFVLYEEEIAYSAKLLKKPDQCRAVYACSHLFWVDDQDEIKDGERYLYYFEKGNP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G438440`
TK1151 ID	TkA02G438440
OH-1004 ID	LXL04_024679
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	59.200
Protein coverage (%)	TK1151 62.051 / OH-1004 19.848 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G438440

Location Chr02:111386295-111387963 (+)

Description Similar to VPS35B: Vacuolar protein sorting-associated protein 35B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75850`	Plays a role in vesicular protein sorting.	Arabidopsis VPS35, a retromer component, is required for vacuolar protein sorting and involved in plant growth and leaf senescence.2008 · DOI: 10.1093/pcp/pcn006
`At3g51310`	Plays a role in vesicular protein sorting.	No verified direct reference in this release
`At2g17790`	Plays a role in vesicular protein sorting.	Loss-of-function mutations of retromer large subunit genes suppress the phenotype of an Arabidopsis zig mutant that lacks Qb-SNARE VTI11.2010 · DOI: 10.1105/tpc.109.069294

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024679 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006624 vacuolar protein processing Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0007040 lysosome organization Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0010821 regulation of mitochondrion organization Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0031648 protein destabilization Biological Process

GO:0032456 endocytic recycling Biological Process

GO:0032463 negative regulation of protein homooligomerization Biological Process

GO:0036010 protein localization to endosome Biological Process

GO:0042147 retrograde transport, endosome to Golgi Biological Process

KEGG gene cross-reference

ath:AT1G75850

ath:AT2G17790

ath:AT3G51310

bta:521864

mmu:65114

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.468

Rank 1 · TkA02G438440 · TK1151

Nucleus0.399

Rank 2 · TkA02G438440 · TK1151

Endoplasmic reticulum0.093

Rank 3 · TkA02G438440 · TK1151

Mitochondrion0.083

Rank 4 · TkA02G438440 · TK1151

Cell membrane0.069

Rank 5 · TkA02G438440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03847TFIID_20kDa14-33 aa

PF03635Vps3567-150 aa

PF03635Vps35150-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G438440	`PF03847`	TFIID_20kDa	14	33	0.00054	21.0
TkA02G438440	`PF03635`	Vps35	67	150	6.7e-26	91.7
TkA02G438440	`PF03635`	Vps35	150	188	6.7e-26	91.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I0P8`	Arabidopsis thaliana	sp\|F4I0P8\|VP35B_ARATH Vacuolar protein sorting-associated protein 35B	60.600%	Swiss-Prot	Medium
`A8R7K9`	Arabidopsis thaliana	sp\|A8R7K9\|VP35C_ARATH Vacuolar protein sorting-associated protein 35C	43.700%	Swiss-Prot	Medium
`Q7X659`	Arabidopsis thaliana	sp\|Q7X659\|VP35A_ARATH Vacuolar protein sorting-associated protein 35A	47.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card