TkA02G436030 | RubberDandelionOmics

Gene overview

TkA02G436030

Reference: TK1151 Chr: Chr02 Coordinates: 110817401-110820008 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1218 bp · TkA02G436030|TK1151|cDNA

AACCAATCCAAAAGTGTTTCCCGTCGCTTGTGAAGGAGAACGAACAGTTTCATAAACGATCACGCTTCCTTAATTGCTCATAAAATTGAGAGGACATATATTAGAAATGACTATCACCAATGACAAGGAACCACAATACCCACCTCCGGCCAACGCCGATAACCTTTTTGAACAACCACTTCCACCACCTCACATGAACTCCAACCACCGTGAAGAACCGCCTTTTACTCCTCTTCCACCTCCGTTCCATGAACTTCGAA...

CDS

Download CDS FASTA

870 bp · TkA02G436030|TK1151|CDS

ATGACTATCACCAATGACAAGGAACCACAATACCCACCTCCGGCCAACGCCGATAACCTTTTTGAACAACCACTTCCACCACCTCACATGAACTCCAACCACCGTGAAGAACCGCCTTTTACTCCTCTTCCACCTCCGTTCCATGAACTTCGAAGTTACAAAGAAATCTTAATTTGCCTTACCCACCTCTTCCACCACCTTCGTCTGAACCACCACAACGCCTCCTGCCCTGGCTGTGATGACGAATCTCTTCTTACCCT...

Protein

Download Protein FASTA

289 aa · TkA02G436030|TK1151|PROTEIN

MTITNDKEPQYPPPANADNLFEQPLPPPHMNSNHREEPPFTPLPPPFHELRSYKEILICLTHLFHHLRLNHHNASCPGCDDESLLTLNPNANVYSEQPADNFDSDMAVYYRLPPPPQPVYHGGHHSLPQNPTNYLDNKPTFRVYTKAKTDYSLTIRNGKVILAPTNSSDLHQHWIKDEKFGSSIKDEKGNPAFALVNKATGEAMKFSIGVTYPVQLKKYNPNEVDMTVLWSESNDLGDGYRSFRTVTNIHLNLDACKGVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G436030`
TK1151 ID	TkA02G436030
OH-1004 ID	LXL04_014352
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	70.400
Protein coverage (%)	TK1151 100.000 / OH-1004 96.928 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G436030

Location Chr02:110817401-110820008 (-)

Description Similar to EULS3: Ricin B-like lectin EULS3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39050`	Lectin which binds carbohydrates in vitro.	The Arabidopsis lectin EULS3 is involved in stomatal closure.2015 · DOI: 10.1016/j.plantsci.2015.07.005

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0684000`	Lectin which binds carbohydrates in vitro.	No verified direct reference in this release
`Os03g0327600`	Lectin which binds carbohydrates in vitro.	No verified direct reference in this release
`Os07g0683900`	Lectin which binds carbohydrates in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014352 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0042742 defense response to bacterium Biological Process

GO:0090332 stomatal closure Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT2G39050

dosa:Os03g0327600

dosa:Os07g0683900

dosa:Os07g0684000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.542

Rank 1 · TkA02G436030 · TK1151

Nucleus0.341

Rank 2 · TkA02G436030 · TK1151

Cell membrane0.115

Rank 3 · TkA02G436030 · TK1151

Extracellular0.106

Rank 4 · TkA02G436030 · TK1151

Endoplasmic reticulum0.082

Rank 5 · TkA02G436030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00652Ricin_B_lectin149-177 aa

PF14200RicinB_lectin_2159-205 aa

PF14200RicinB_lectin_2172-274 aa

PF00652Ricin_B_lectin255-284 aa

PF14200RicinB_lectin_2261-287 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G436030	`PF00652`	Ricin_B_lectin	149	177	0.14	13.1
TkA02G436030	`PF14200`	RicinB_lectin_2	159	205	0.00055	21.3
TkA02G436030	`PF14200`	RicinB_lectin_2	172	274	0.00055	21.3
TkA02G436030	`PF00652`	Ricin_B_lectin	255	284	0.14	13.1
TkA02G436030	`PF14200`	RicinB_lectin_2	261	287	0.00055	21.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q945P1`	Arabidopsis thaliana	sp\|Q945P1\|EULS3_ARATH Ricin B-like lectin EULS3	55.800%	Swiss-Prot	Medium
`Q6Z4N4`	Oryza sativa subsp. japonica	sp\|Q6Z4N4\|40G3_ORYSJ Ricin B-like lectin R40G3	56.800%	Swiss-Prot	Medium
`Q10M12`	Oryza sativa subsp. japonica	sp\|Q10M12\|40C1_ORYSJ Ricin B-like lectin R40C1	52.000%	Swiss-Prot	Medium
`Q6Z4N6`	Oryza sativa subsp. japonica	sp\|Q6Z4N6\|40G2_ORYSJ Ricin B-like lectin R40G2	56.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card