TkA02G433610 | RubberDandelionOmics

Gene overview

TkA02G433610

Reference: TK1151 Chr: Chr02 Coordinates: 110184560-110193912 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6205 bp · TkA02G433610|TK1151|cDNA

TTTATGAAGTTCAAAACTTCAGTTTCATGTAGGTTGGTTTTAAGTTTAACCGGGAAACCATAGAACCCTAAACCCTAATCCGGTCCACCATTTGATCCTCCGTTGTCCACAAGCCGACGCCCTTCTTCCTTGACCACCCTTCTTCACCAACTGAACGTAGAAACCATCCGTTCGGCGTCCTGGTGCAAGGGGGTTGCATTCTCTCTCCGCCGCCTGATTCCTGACTCGCTGCAGTCTGCACTTCGAGTCTAGACTTTTCA...

CDS

Download CDS FASTA

4689 bp · TkA02G433610|TK1151|CDS

ATGCTCGTGTGCTTTCAACTCTTGAAAATGGGATCCTACTCTCTTTCCTCACATTCTTTACTGGAACTTGTTGATGTATTTCATTTGGGAAAAACTCTCCCTGATTCAAAGTGGAAAGAGGAGTACCCTCAAAATAAGAAGGTTAATGCTAGGATATTGTTCATTGACCAGTCAAGCAGAGCTGTTGGGTTGACTTTAAATCCTCATCTTGTTCATAACAATGCTCCACCTGCACTTGTTAAAGTTGGAGATATTTTTGA...

Protein

Download Protein FASTA

1562 aa · TkA02G433610|TK1151|PROTEIN

MLVCFQLLKMGSYSLSSHSLLELVDVFHLGKTLPDSKWKEEYPQNKKVNARILFIDQSSRAVGLTLNPHLVHNNAPPALVKVGDIFDDSKVVRVDRGSGLLLEIPSTPVPTPAYVNVSDLSDKEVKKWEKSFKEGSLVRVRVFGFRLLEGLATGVLKTSAFEGTVFTHSDVRPGMVVKAKVAIVDSFGAIVQFATGVKALCPLRHMSEFEIVKPRKKFQVGAELVFRVLGIKSKRITVTHKKTLVKSKLPILSSYTDATE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G433610`
TK1151 ID	TkA02G433610
OH-1004 ID	LXL04_014364
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 98.528 / OH-1004 81.472 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G433610

Location Chr02:110184560-110193912 (-)

Description Similar to RRP5: rRNA biogenesis protein RRP5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11964`	Involved in the biogenesis of ribosomal RNA (rRNA).	40S ribosome biogenesis co-factors are essential for gametophyte and embryo development.2013 · DOI: 10.1371/journal.pone.0054084

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014364 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0009553 embryo sac development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0032040 small-subunit processome Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0051059 NF-kappaB binding Molecular Function

KEGG gene cross-reference

ath:AT3G11964

hsa:22984

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.842

Rank 1 · TkA02G433610 · TK1151

Cytoplasm0.189

Rank 2 · TkA02G433610 · TK1151

Mitochondrion0.026

Rank 3 · TkA02G433610 · TK1151

Cell membrane0.026

Rank 4 · TkA02G433610 · TK1151

Endoplasmic reticulum0.017

Rank 5 · TkA02G433610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23459S1_RRP524-65 aa

PF21710Spt6_S136-69 aa

PF24685OB_RRP5_4th37-53 aa

PF24685OB_RRP5_4th75-166 aa

PF00575S182-143 aa

PF23459S1_RRP5113-144 aa

PF23241HAT_PRP39_C114-130 aa

PF29086OB_PDCD11126-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G433610	`PF23459`	S1_RRP5	24	65	5.3e-57	191.0
TkA02G433610	`PF21710`	Spt6_S1	36	69	1.6e-20	73.9
TkA02G433610	`PF24685`	OB_RRP5_4th	37	53	9.1e-59	196.2
TkA02G433610	`PF24685`	OB_RRP5_4th	75	166	9.1e-59	196.2
TkA02G433610	`PF00575`	S1	82	143	1.7e-65	218.0
TkA02G433610	`PF23459`	S1_RRP5	113	144	5.3e-57	191.0
TkA02G433610	`PF23241`	HAT_PRP39_C	114	130	5.2e-13	50.0
TkA02G433610	`PF29086`	OB_PDCD11	126	146	1.5e-26	93.1
TkA02G433610	`PF29086`	OB_PDCD11	164	235	1.5e-26	93.1
TkA02G433610	`PF21710`	Spt6_S1	167	238	1.6e-20	73.9
TkA02G433610	`PF23459`	S1_RRP5	171	231	5.3e-57	191.0
TkA02G433610	`PF00575`	S1	172	235	1.7e-65	218.0
TkA02G433610	`PF13509`	S1_2	174	206	0.046	14.5
TkA02G433610	`PF24685`	OB_RRP5_4th	199	233	9.1e-59	196.2
TkA02G433610	`PF29086`	OB_PDCD11	253	289	1.5e-26	93.1
TkA02G433610	`PF06211`	BAMBI	253	316	0.21	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J8K6`	Arabidopsis thaliana	sp\|F4J8K6\|RRP5_ARATH rRNA biogenesis protein RRP5	56.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card