TkA02G432860 | RubberDandelionOmics

Gene overview

TkA02G432860

Reference: TK1151 Chr: Chr02 Coordinates: 109976937-109979320 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1044 bp · TkA02G432860|TK1151|cDNA

CGTGTATTGCGCAAGTTACGTCCTATTACTATCCCTCTCACGGCTAATCCACATAATTTTCGAAAATTAATATCATCTTCCATCCAATATTGTTCTTCATCATCACTTGAATTAGATGCATCATTATCCATCCTATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATAT...

CDS

Download CDS FASTA

1044 bp · TkA02G432860|TK1151|CDS

CGTGTATTGCGCAAGTTACGTCCTATTACTATCCCTCTCACGGCTAATCCACATAATTTTCGAAAATTAATATCATCTTCCATCCAATATTGTTCTTCATCATCACTTGAATTAGATGCATCATTATCCATCCTATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATAT...

Protein

Download Protein FASTA

347 aa · TkA02G432860|TK1151|PROTEIN

RVLRKLRPITIPLTANPHNFRKLISSSIQYCSSSSLELDASLSILYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYIYRMDSDASNSSDDEEQYWMKDDINFRKLCGLAVRGIVIGRNLRNTRNQCHTSDDTGYKFVTKILNGNGKRCYQMFRLHVPVYRKLCKDFVTNYGLTQTRNIGIEESVAIFLVCLAHGCTNRFMQELFNHSGETISRHFYKVLEAVLKMSAVIIKPDENYNQNVPDYILN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G432860`
TK1151 ID	TkA02G432860
OH-1004 ID	LXL04_038652
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.400
Protein coverage (%)	TK1151 71.758 / OH-1004 31.559 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G432860`
Location	Chr02:109976937-109979320 (+)
Description	Similar to LIMYB: L10-interacting MYB domain-containing protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038652` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific Molecular Function GO:0004518 nuclease activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ath:AT5G05800 bta:514442 rno:690164 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.877

Rank 1 · TkA02G432860 · TK1151

Cytoplasm0.215

Rank 2 · TkA02G432860 · TK1151

Mitochondrion0.025

Rank 3 · TkA02G432860 · TK1151

Cell membrane0.019

Rank 4 · TkA02G432860 · TK1151

Endoplasmic reticulum0.017

Rank 5 · TkA02G432860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06398Pex24p41-154 aa

PF26138DUF8040142-238 aa

PF01609DDE_Tnp_1268-338 aa

PF13359DDE_Tnp_4275-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G432860	`PF06398`	Pex24p	41	154	0.0016	18.2
TkA02G432860	`PF26138`	DUF8040	142	238	3.3e-35	120.6
TkA02G432860	`PF01609`	DDE_Tnp_1	268	338	0.003	18.0
TkA02G432860	`PF13359`	DDE_Tnp_4	275	333	2.4e-08	34.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card