TkA02G432780 | RubberDandelionOmics

Gene overview

TkA02G432780

Reference: TK1151 Chr: Chr02 Coordinates: 109961085-109965139 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

683 bp · TkA02G432780|TK1151|cDNA

ATAATAATGAAGCTCATGGTGGATATACACAAACGCTGAAGGAATCAGATAAGATCAACCGGAATCGGCATAAAATGGGTGGTTTGAAAGCGGTGGCAGTCATCACCGGCGGTGAAAACTCCGTCAAAGGGTCTCTTCAGTTCTTCCAAGAAGCCAATGGGGTAACTCATGTGAGCGGTAAGATAACAGGGCTCAAACCAGGTCTCCATGGATTCCATATTCATGCTCTTGGTGATACCACTAATGGCTGCAACTCCACA...

CDS

Download CDS FASTA

426 bp · TkA02G432780|TK1151|CDS

ATGGGTGGTTTGAAAGCGGTGGCAGTCATCACCGGCGGTGAAAACTCCGTCAAAGGGTCTCTTCAGTTCTTCCAAGAAGCCAATGGGGTAACTCATGTGAGCGGTAAGATAACAGGGCTCAAACCAGGTCTCCATGGATTCCATATTCATGCTCTTGGTGATACCACTAATGGCTGCAACTCCACAGGACCTCATTTCAATCCCTTAAAGAATGATCATGGAGCACCTCAAGATGATGTACGCCATGCAGGCGATTTGGG...

Protein

Download Protein FASTA

141 aa · TkA02G432780|TK1151|PROTEIN

MGGLKAVAVITGGENSVKGSLQFFQEANGVTHVSGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKNDHGAPQDDVRHAGDLGNIVAGQAGVAEVSIKDKHIPLSGIYSILGRAVVIHADPDDLGRGGHELSKTTGN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G432780`
TK1151 ID	TkA02G432780
OH-1004 ID	LXL04_014370
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 86.503 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G432780

Location Chr02:109961085-109965139 (-)

Description Similar to SODCC.2: Superoxide dismutase [Cu-Zn] 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18100`	Destroys radicals which are normally produced within the cells and which are toxic to biological systems.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0665200`	Destroys radicals which are normally produced within the cells and which are toxic to biological systems.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014370 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0019430 removal of superoxide radicals Biological Process

GO:0071457 cellular response to ozone Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:0071484 cellular response to light intensity Biological Process

GO:0071486 cellular response to high light intensity Biological Process

GO:0071493 cellular response to UV-B Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004784 superoxide dismutase activity Molecular Function

KEGG gene cross-reference

ath:AT5G18100

dosa:Os07g0665200

zof:121982055

zof:121985924

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.486

Rank 1 · TkA02G432780 · TK1151

Mitochondrion0.320

Rank 2 · TkA02G432780 · TK1151

Nucleus0.215

Rank 3 · TkA02G432780 · TK1151

Extracellular0.106

Rank 4 · TkA02G432780 · TK1151

Cell membrane0.082

Rank 5 · TkA02G432780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00080Sod_Cu17-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G432780	`PF00080`	Sod_Cu	17	141	1e-41	143.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FK60`	Arabidopsis thaliana	sp\|Q9FK60\|SODC3_ARATH Superoxide dismutase [Cu-Zn] 3	72.100%	Swiss-Prot	High
`P28757`	Oryza sativa subsp. japonica	sp\|P28757\|SODC2_ORYSJ Superoxide dismutase [Cu-Zn] 2	69.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card