TkA02G432740 | RubberDandelionOmics

Gene overview

TkA02G432740

Reference: TK1151 Chr: Chr02 Coordinates: 109945322-109945741 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

420 bp · TkA02G432740|TK1151|cDNA

TCATCACAGCAGCGATTCCCTTCGTTTTCACACCCAAGAACAGGACTCAGAAACTTATCTTTCCAGAGTAAAAAAAAGAGAAGTCCAATTAAAGCCTCGTTGTCCGATTCTTCTGGATCCGATGCACCAATTGCCCCACTCGAGTTAGAATCCCCAATCGGGCAGTTCCTATCCCAAATTCTGGTCAGCCACCCTCACCTCCTGCCCGCAGCAGTCGAACAGCAGCTCGAACAACTTCAAACTGACCGCGATGCTCAACA...

CDS

Download CDS FASTA

420 bp · TkA02G432740|TK1151|CDS

TCATCACAGCAGCGATTCCCTTCGTTTTCACACCCAAGAACAGGACTCAGAAACTTATCTTTCCAGAGTAAAAAAAAGAGAAGTCCAATTAAAGCCTCGTTGTCCGATTCTTCTGGATCCGATGCACCAATTGCCCCACTCGAGTTAGAATCCCCAATCGGGCAGTTCCTATCCCAAATTCTGGTCAGCCACCCTCACCTCCTGCCCGCAGCAGTCGAACAGCAGCTCGAACAACTTCAAACTGACCGCGATGCTCAACA...

Protein

Download Protein FASTA

139 aa · TkA02G432740|TK1151|PROTEIN

SSQQRFPSFSHPRTGLRNLSFQSKKKRSPIKASLSDSSGSDAPIAPLELESPIGQFLSQILVSHPHLLPAAVEQQLEQLQTDRDAQQETEQPSAQTTDLALYKKKIPLVPSVTPKASTPPFTRSPRDESIHCSNGNFDF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G432740`
TK1151 ID	TkA02G432740
OH-1004 ID	LXL04_026861
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.300
Protein coverage (%)	TK1151 50.360 / OH-1004 57.851 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G432740

Location Chr02:109945322-109945741 (+)

Description Similar to At3g17800: UV-B-induced protein At3g17800, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17800`	UV-B-induced protein At3g17800, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026861 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0010193 response to ozone Biological Process

GO:0010224 response to UV-B Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT3G17800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.876

Rank 1 · TkA02G432740 · TK1151

Mitochondrion0.085

Rank 2 · TkA02G432740 · TK1151

Nucleus0.077

Rank 3 · TkA02G432740 · TK1151

Cytoplasm0.051

Rank 4 · TkA02G432740 · TK1151

Cell membrane0.021

Rank 5 · TkA02G432740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08439Peptidase_M3_N53-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G432740	`PF08439`	Peptidase_M3_N	53	85	0.18	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVJ0`	Arabidopsis thaliana	sp\|Q9LVJ0\|UVB31_ARATH UV-B-induced protein At3g17800, chloroplastic	58.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card