TkA02G427340 | RubberDandelionOmics

Gene overview

TkA02G427340

Reference: TK1151 Chr: Chr02 Coordinates: 108571548-108572915 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1368 bp · TkA02G427340|TK1151|cDNA

ATGGCTCCTCCTTCTTATCTCTTATTTCTCACTCTTATCTCTATACTCAATCTCTGTATCCCTTCATCTTCTTCACTCGACACCCTCACACTTTCTCTAACCCAACACATTGCACCAGAAACCAACAAACATCCATGGCTGCAGACCATAAACTCCCTCGCGTCATCTTCTATAACCAGAGCGCATCACCTCAAAAACCCCAATTCTTCTTCAACCTCAAAAATCAATCTATTTCCTCAAAGCTATGGCGGATACTCTGT...

CDS

Download CDS FASTA

1368 bp · TkA02G427340|TK1151|CDS

ATGGCTCCTCCTTCTTATCTCTTATTTCTCACTCTTATCTCTATACTCAATCTCTGTATCCCTTCATCTTCTTCACTCGACACCCTCACACTTTCTCTAACCCAACACATTGCACCAGAAACCAACAAACATCCATGGCTGCAGACCATAAACTCCCTCGCGTCATCTTCTATAACCAGAGCGCATCACCTCAAAAACCCCAATTCTTCTTCAACCTCAAAAATCAATCTATTTCCTCAAAGCTATGGCGGATACTCTGT...

Protein

Download Protein FASTA

455 aa · TkA02G427340|TK1151|PROTEIN

MAPPSYLLFLTLISILNLCIPSSSSLDTLTLSLTQHIAPETNKHPWLQTINSLASSSITRAHHLKNPNSSSTSKINLFPQSYGGYSVSLSFGSPPQKLSFVMDTGSSLVWFPCTHRYTCSDCSFPNVNQTNIPKFIPKLSSSAKLIGCKNKKCGWVFGSTDPIQCNGNQMCPAYMLQYGSGSTSGLLLSETLDFNEGDATDFLVGCSILSTRQPSGIAGFGRGSASLPVQMGLKKFSYCLVSHKYDDAPVSSDLILVRSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G427340`
TK1151 ID	TkA02G427340
OH-1004 ID	LXL04_014418
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G427340

Location Chr02:108571548-108572915 (-)

Description Similar to nep2: Aspartic proteinase nepenthesin-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01300`	Aspartyl protease.	No verified direct reference in this release
`At5g36260`	Displays aspartic proteolytic activity.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0448500`	Anther-specific aspartic protease involved in tapetal programmed cell death (PCD).	EAT1 promotes tapetal cell death by regulating aspartic proteases during male reproductive development in rice.2013 · DOI: 10.1038/ncomms2396

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014418 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01300

ath:AT4G16563

dosa:Os03g0186900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.506

Rank 1 · TkA02G427340 · TK1151

Cell membrane0.204

Rank 2 · TkA02G427340 · TK1151

Endoplasmic reticulum0.125

Rank 3 · TkA02G427340 · TK1151

Cytoplasm0.077

Rank 4 · TkA02G427340 · TK1151

Lysosome / Vacuole0.052

Rank 5 · TkA02G427340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543TAXi_N85-243 aa

PF00026Asp85-450 aa

PF13920zf-C3HC4_3104-123 aa

PF23739HTH_72286-312 aa

PF14541TAXi_C290-451 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G427340	`PF14543`	TAXi_N	85	243	3.4e-27	96.5
TkA02G427340	`PF00026`	Asp	85	450	5.4e-22	79.3
TkA02G427340	`PF13920`	zf-C3HC4_3	104	123	0.024	15.1
TkA02G427340	`PF23739`	HTH_72	286	312	0.21	12.3
TkA02G427340	`PF14541`	TAXi_C	290	451	5.3e-37	127.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNJ3`	Arabidopsis thaliana	sp\|Q9LNJ3\|APF2_ARATH Aspartyl protease family protein 2	30.900%	Swiss-Prot	Medium
`Q4V3D2`	Arabidopsis thaliana	sp\|Q4V3D2\|ASP36_ARATH Aspartic proteinase 36	26.500%	Swiss-Prot	Low
`Q7XV21`	Oryza sativa subsp. japonica	sp\|Q7XV21\|AP37_ORYSJ Aspartyl protease 37	25.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card