TkA02G425800 | RubberDandelionOmics

Gene overview

TkA02G425800

Reference: TK1151 Chr: Chr02 Coordinates: 108161165-108166727 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1628 bp · TkA02G425800|TK1151|cDNA

ACCCATGGAGATTGCGTGCAAGGCTTCACTTTTCAATATGAAAGCTCCAATTATCGATTTAGTCAAGAGAATACAGAAGGTTGGAAAAGATGATCCGAGAAGAATCATGCACTCCTTCAAAGTCGCATTAGCAATCACATTGGTCTCCATGGTGTACTATCTGAGGCCATTATATAAAGGCATGGGCGATGCAGGCATCTGGGCTATCTTGACTGTCGTTGTGGTGTTTGAATATACAGCCGGTGCAACTTTATGCAAGG...

CDS

Download CDS FASTA

1353 bp · TkA02G425800|TK1151|CDS

ATGGAGATTGCGTGCAAGGCTTCACTTTTCAATATGAAAGCTCCAATTATCGATTTAGTCAAGAGAATACAGAAGGTTGGAAAAGATGATCCGAGAAGAATCATGCACTCCTTCAAAGTCGCATTAGCAATCACATTGGTCTCCATGGTGTACTATCTGAGGCCATTATATAAAGGCATGGGCGATGCAGGCATCTGGGCTATCTTGACTGTCGTTGTGGTGTTTGAATATACAGCCGGTGCAACTTTATGCAAGGGTAT...

Protein

Download Protein FASTA

450 aa · TkA02G425800|TK1151|PROTEIN

MEIACKASLFNMKAPIIDLVKRIQKVGKDDPRRIMHSFKVALAITLVSMVYYLRPLYKGMGDAGIWAILTVVVVFEYTAGATLCKGMNRGLATLLAGALGLGAEYLARLFGPKAEPIVLGCLVFLLVAAATFSRFIPHIKKRYDYGVLIFILTFSLVAVSGYRVEKIMELANQRLLTIILGGVTCIIISLCVCPVWAGEDLHILIVANLEKLARYLEGFGGEMFQLPLEGESGDRSMEIDKLFLGAYKSVLSSKATEESL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G425800`
TK1151 ID	TkA02G425800
OH-1004 ID	LXL04_026272
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	40.400
Protein coverage (%)	TK1151 90.444 / OH-1004 87.677 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G425800

Location Chr02:108161165-108166727 (-)

Description Similar to ALMT10: Aluminum-activated malate transporter 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11680`	Malate transporter.	No verified direct reference in this release
`At1g08440`	Malate transporter.	No verified direct reference in this release
`At2g27240`	Malate transporter.	No verified direct reference in this release
`At1g08430`	Malate transporter critical for aluminum tolerance.	AtALMT1, which encodes a malate transporter, is identified as one of several genes critical for aluminum tolerance in Arabidopsis.2006 · DOI: 10.1073/pnas.0602868103 Characterization of AtALMT1 expression in aluminum-inducible malate release and its role for rhizotoxic stress tolerance in Arabidopsis.2007 · DOI: 10.1104/pp.107.102335 Aluminum-activated citrate and malate transporters from the MATE and ALMT families function independently to confer Arabidopsis aluminum tolerance.2009 · DOI: 10.1111/j.1365-313x.2008.03696.x STOP1 regulates multiple genes that protect arabidopsis from proton and aluminum toxicities.2009 · DOI: 10.1104/pp.108.134700

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026272 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

ath:AT1G08440

ath:AT2G27240

ath:AT3G11680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.872

Rank 1 · TkA02G425800 · TK1151

Endoplasmic reticulum0.095

Rank 2 · TkA02G425800 · TK1151

Cytoplasm0.063

Rank 3 · TkA02G425800 · TK1151

Nucleus0.034

Rank 4 · TkA02G425800 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA02G425800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11744ALMT25-368 aa

PF04756OST3_OST640-81 aa

PF13515FUSC_249-187 aa

PF04632FUSC65-215 aa

PF10225NEMP117-193 aa

PF04756OST3_OST6134-163 aa

PF10225NEMP303-330 aa

PF11744ALMT371-407 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G425800	`PF11744`	ALMT	25	368	4.3e-145	485.0
TkA02G425800	`PF04756`	OST3_OST6	40	81	2.3	8.2
TkA02G425800	`PF13515`	FUSC_2	49	187	4.4e-09	37.2
TkA02G425800	`PF04632`	FUSC	65	215	0.75	9.0
TkA02G425800	`PF10225`	NEMP	117	193	1.4	9.2
TkA02G425800	`PF04756`	OST3_OST6	134	163	2.3	8.2
TkA02G425800	`PF10225`	NEMP	303	330	1.4	9.2
TkA02G425800	`PF11744`	ALMT	371	407	4.3e-145	485.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRM9`	Arabidopsis thaliana	sp\|Q9SRM9\|ALMT8_ARATH Aluminum-activated malate transporter 8	53.100%	Swiss-Prot	High
`Q9SJE8`	Arabidopsis thaliana	sp\|Q9SJE8\|ALMT2_ARATH Aluminum-activated malate transporter 2	46.000%	Swiss-Prot	Medium
`Q9XIN1`	Arabidopsis thaliana	sp\|Q9XIN1\|ALMT7_ARATH Aluminum-activated malate transporter 7	44.500%	Swiss-Prot	Medium
`Q9SJE9`	Arabidopsis thaliana	sp\|Q9SJE9\|ALMT1_ARATH Aluminum-activated malate transporter 1	45.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card