TkA02G424640 | RubberDandelionOmics

Gene overview

TkA02G424640

Reference: TK1151 Chr: Chr02 Coordinates: 107862610-107865719 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1632 bp · TkA02G424640|TK1151|cDNA

AGAAAAAGGCGAAATAGGAAAAATCCATAAGAGCAATATGTTATTGGTCACTATAATGCAGCCAACCAACCCCATTGCTTCATGTTTTCACTCATTGGTCTCTTTCCTGTTTCACTTTCATCGATCTCCCTTTCCTCTTCAAGTTCTTCAAACTGTATCACCACGGCACCTGTCAAGTGTCAACTGGGAATTCTCTTTCTCTACTTCATGATTGGATTTTGAATTTTATCACTCTCTCTCTCTTTTCTCAATTGGAAATC...

CDS

Download CDS FASTA

894 bp · TkA02G424640|TK1151|CDS

ATGACAATGAATTCTGTTTATAACAAAGAACAGGAAGGTTTGACTCCGATGGGTTCACCATCGCCGGGTTCGGTTCCTTGGTGGAGTGGACTTGTGACTGGATCAACTCCTGAAGAATCAATCAAAACGAAGCCTTCATCAATCGATAACCACACTCCTTACGGATCAAAATTCACACAAATTACACCGAAAAAGTCAGATCGTGATGCAGAACAAGTGTTCGACAAAAATGATATAACTCAATTCAATATCTTCACCGG...

Protein

Download Protein FASTA

297 aa · TkA02G424640|TK1151|PROTEIN

MTMNSVYNKEQEGLTPMGSPSPGSVPWWSGLVTGSTPEESIKTKPSSIDNHTPYGSKFTQITPKKSDRDAEQVFDKNDITQFNIFTGNDIGKLDQSASDSDDGKNLSNTQKPTKFQADYAELAFSQPTMLCGKYPFTDQYYGVFSSYGPQITGRIMLPLNLSSDDGPTFVNAKQYHGIIRRRRSRAKAEMANKALKNRKPYLHHSRHLHAIRRPRGNGGRFLNTKKENKCKEENKNNGNNNMFSLADLKSLPNGNNLSGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G424640`
TK1151 ID	TkA02G424640
OH-1004 ID	LXL04_014450
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G424640

Location Chr02:107862610-107865719 (-)

Description Similar to NFYA10: Nuclear transcription factor Y subunit A-10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06510`	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.	No verified direct reference in this release
`At3g05690`	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity).	No verified direct reference in this release
`At1g30500`	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.	No verified direct reference in this release
`At2g34720`	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.	No verified direct reference in this release
`At1g72830`	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014450 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009408 response to heat Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0005634 nucleus Cellular Component

GO:0016602 CCAAT-binding factor complex Cellular Component

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G30500

ath:AT1G72830

ath:AT2G34720

ath:AT3G05690

ath:AT5G06510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.417

Rank 1 · TkA02G424640 · TK1151

Cytoplasm0.212

Rank 2 · TkA02G424640 · TK1151

Nucleus0.168

Rank 3 · TkA02G424640 · TK1151

Cell membrane0.099

Rank 4 · TkA02G424640 · TK1151

Endoplasmic reticulum0.097

Rank 5 · TkA02G424640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02045CBFB_NFYA121-236 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G424640	`PF02045`	CBFB_NFYA	121	236	1.5e-36	126.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LFU0`	Arabidopsis thaliana	sp\|Q8LFU0\|NFYAA_ARATH Nuclear transcription factor Y subunit A-10	43.100%	Swiss-Prot	Medium
`Q9M9X4`	Arabidopsis thaliana	sp\|Q9M9X4\|NFYA2_ARATH Nuclear transcription factor Y subunit A-2	59.700%	Swiss-Prot	Low
`Q84JP1`	Arabidopsis thaliana	sp\|Q84JP1\|NFYA7_ARATH Nuclear transcription factor Y subunit A-7	50.400%	Swiss-Prot	Low
`Q8VY64`	Arabidopsis thaliana	sp\|Q8VY64\|NFYA4_ARATH Nuclear transcription factor Y subunit A-4	53.400%	Swiss-Prot	Low
`Q93ZH2`	Arabidopsis thaliana	sp\|Q93ZH2\|NFYA3_ARATH Nuclear transcription factor Y subunit A-3	36.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card