TkA02G423240 | RubberDandelionOmics

Gene overview

TkA02G423240

Reference: TK1151 Chr: Chr02 Coordinates: 107481564-107484460 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1516 bp · TkA02G423240|TK1151|cDNA

CCAAAATAAATCAGCCACTTGTGTCCTAAATTATAGCATGCATTTATAACGAGCTCCGTTCTGTTTGACTTCCCCTCTCCTGTACTGCTCTTAAAGCAATCGTTCTAGTTGGGATTCCCATACCGGAGAAACCCAAACAAATACAACTGCTTGATTCACCCTCCATAGATTAGTCATCTGTTTGTCATCAAACACACAGACGATGGCTACCAATCTTCGGAGATTTAAGCGATTTGGTTCCATCTTCACCAACAATTCCA...

CDS

Download CDS FASTA

1113 bp · TkA02G423240|TK1151|CDS

ATGGCTACCAATCTTCGGAGATTTAAGCGATTTGGTTCCATCTTCACCAACAATTCCACCCCTCTCAGACGACTATCTTCCTCTTCCGCCGTTTTGGGTTCTGTTGACGGTCAGCTTCAGCAACCGGGAAGTGGAACGGGGAAATCTATTAACCTTTACACTGCAATTAATCAAGCACTTCAAATAGCTTTAGAGTCTGATCCTCGTTCTTATATATTTGGGGAAGATGTTGGTTTTGGTGGCGTTTTCCGTTGCACGAC...

Protein

Download Protein FASTA

370 aa · TkA02G423240|TK1151|PROTEIN

MATNLRRFKRFGSIFTNNSTPLRRLSSSSAVLGSVDGQLQQPGSGTGKSINLYTAINQALQIALESDPRSYIFGEDVGFGGVFRCTTGLAEQFGKHRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFNCGGLTIRTPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPKEAKGLLLASIREPNPVVFFEPKWLYRLAVEEVPEGDYMVPLSEAEVIREGSDITLVGWGAQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G423240`
TK1151 ID	TkA02G423240
OH-1004 ID	LXL04_014465
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G423240

Location Chr02:107481564-107484460 (-)

Description Similar to DIN4: 2-oxoisovalerate dehydrogenase subunit beta 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55510`	The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2).	No verified direct reference in this release
`At3g13450`	The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014465 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007584 response to nutrient Biological Process

GO:0009063 amino acid catabolic process Biological Process

GO:0009083 branched-chain amino acid catabolic process Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009744 response to sucrose Biological Process

GO:0043617 cellular response to sucrose starvation Biological Process

GO:0051384 response to glucocorticoid Biological Process

GO:0051591 response to cAMP Biological Process

GO:0120552 branched-chain alpha-keto acid decarboxylation to branched-chain acyl-CoA Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G55510

ath:AT3G13450

ddi:DDB_G0268020

mmu:12040

rno:29711

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.930

Rank 1 · TkA02G423240 · TK1151

Cytoplasm0.043

Rank 2 · TkA02G423240 · TK1151

Nucleus0.035

Rank 3 · TkA02G423240 · TK1151

Plastid0.029

Rank 4 · TkA02G423240 · TK1151

Cell membrane0.014

Rank 5 · TkA02G423240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00333Ribosomal_S542-63 aa

PF02779Transket_pyr49-224 aa

PF00333Ribosomal_S5106-124 aa

PF02780Transketolase_C241-360 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G423240	`PF00333`	Ribosomal_S5	42	63	0.19	12.5
TkA02G423240	`PF02779`	Transket_pyr	49	224	1.7e-38	132.7
TkA02G423240	`PF00333`	Ribosomal_S5	106	124	0.19	12.5
TkA02G423240	`PF02780`	Transketolase_C	241	360	3.5e-35	121.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAV3`	Arabidopsis thaliana	sp\|Q9SAV3\|ODBB1_ARATH 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial	90.200%	Swiss-Prot	High
`Q9LDY2`	Arabidopsis thaliana	sp\|Q9LDY2\|ODBB2_ARATH 2-oxoisovalerate dehydrogenase subunit beta 2, mitochondrial	90.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card