TkA02G422960 | RubberDandelionOmics

Gene overview

TkA02G422960

Reference: TK1151 Chr: Chr02 Coordinates: 107397166-107400281 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2108 bp · TkA02G422960|TK1151|cDNA

ACGGAGGAAAAGCGTACGCCTGCTTTCTCCTACGCCTCCTTTCGCCGAACTTCGGGACCTCCGTTCCCCCTCTCCGGTGAAGGATTTCAGCTCCACGTGACTGCTAGCAGCTATGCCGAAACATTACAGGCCTCCGGGGAAGAAGAAGGAAGGTAACGCGGCCAGATATATTACCAGGTCTCAAGCTGCTGTTAAGTCTGCAAGTCAGTCTCTCCGTTTTCAGGAGACTATGTATCTTCAAAGGGTTTTTCCTCGGGACC...

CDS

Download CDS FASTA

936 bp · TkA02G422960|TK1151|CDS

ATGCCGAAACATTACAGGCCTCCGGGGAAGAAGAAGGAAGGTAACGCGGCCAGATATATTACCAGGTCTCAAGCTGCTGTTAAGTCTGCAAGTCAGTCTCTCCGTTTTCAGGAGACTATGTATCTTCAAAGGGTTTTTCCTCGGGACCCAAAGAAGAAGGTGAAGGGAAACCACCATACCTATTATCACATGAAAGATATTTTGTTTCTTAAACATGAGCCACTTCTTGAGAAGTTCCGTGAGATGAGAGCATATGAGAA...

Protein

Download Protein FASTA

311 aa · TkA02G422960|TK1151|PROTEIN

MPKHYRPPGKKKEGNAARYITRSQAAVKSASQSLRFQETMYLQRVFPRDPKKKVKGNHHTYYHMKDILFLKHEPLLEKFREMRAYEKKVKKAVCKKNRDLAERLLTRKPSYTLDMLIKERYPKFIDALRDLDDGLTMVHLFAALPAIERENIQAERIHNCRGLSLEWQAYVSRTHKLRKAFISVKGIYYQAEVEGQKITWLTPHALQQVMPQDVDYKIMLTFLEFYETLLGFINLRLYSSISLKYPPILDPRLKALAADL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G422960`
TK1151 ID	TkA02G422960
OH-1004 ID	LXL04_014471
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.900
Protein coverage (%)	TK1151 99.678 / OH-1004 52.901 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G422960

Location Chr02:107397166-107400281 (+)

Description Similar to PES: Pescadillo homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14520`	Required for maturation of ribosomal RNAs and formation of the large ribosomal subunit (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0699200`	Required for maturation of ribosomal RNAs and formation of the large ribosomal subunit.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014471 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0090069 regulation of ribosome biogenesis Biological Process

GO:1902626 assembly of large subunit precursor of preribosome Biological Process

GO:2000232 regulation of rRNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0030684 preribosome Cellular Component

GO:0030687 preribosome, large subunit precursor Cellular Component

GO:0070545 PeBoW complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G14520

dosa:Os03g0699200

nve:5502932

spo:2540659

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.521

Rank 1 · TkA02G422960 · TK1151

Cytoplasm0.367

Rank 2 · TkA02G422960 · TK1151

Mitochondrion0.063

Rank 3 · TkA02G422960 · TK1151

Endoplasmic reticulum0.054

Rank 4 · TkA02G422960 · TK1151

Cell membrane0.049

Rank 5 · TkA02G422960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06732Pescadillo_N10-272 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G422960	`PF06732`	Pescadillo_N	10	272	2.1e-100	336.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYK7`	Arabidopsis thaliana	sp\|Q9LYK7\|PESC_ARATH Pescadillo homolog	66.900%	Swiss-Prot	High
`Q851S7`	Oryza sativa subsp. japonica	sp\|Q851S7\|PESC_ORYSJ Pescadillo homolog	66.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card