TkA02G422940 | RubberDandelionOmics

Gene overview

TkA02G422940

Reference: TK1151 Chr: Chr02 Coordinates: 107392977-107395895 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1963 bp · TkA02G422940|TK1151|cDNA

AAAAACGGAAGGAAGAGCAGAACTGCAGAGTCGCCGCGTCTAGGGAGCTGCAGAGCGTCGGAGGAGCGTCGGAGGAGCGCCGGAGGGCCGATGAGGAGCGCCGGTGGTCGCGTCGCGATTCGCGAAGTGGAAGTGTGGAACTGGAAACGTGGATGGCGGATGAAGATTGAAGAACTGTGCTATGCGGCCGCTTTTTTCTTTGAATATGAGGAAGTCAAAAGAAAGTGAAAAACATGTTTCTTGGTTCTTTTACGGCCGTG...

CDS

Download CDS FASTA

453 bp · TkA02G422940|TK1151|CDS

ATGTGCTACAAGTACCTTTGGGACAACCTAGTCGCTAATCCATTTCCCATTCAACAATTCTTAAAATTGTTTTCCTTAAACCCTAACTACGTTTTATCCCAACAAATCCAAGAAACTGCTCTCCAAGCAGGTGTCCCCGCCCAGACCTTTCATGACGTACTAACGCAATACCAATACATCTGTTCCAAGCTGCCTAAAACTCACGACCAGCTTTTGTTAAGATACGAGTACCAAAAAGATCAATCTCTGATAGGTGAGAA...

Protein

Download Protein FASTA

150 aa · TkA02G422940|TK1151|PROTEIN

MCYKYLWDNLVANPFPIQQFLKLFSLNPNYVLSQQIQETALQAGVPAQTFHDVLTQYQYICSKLPKTHDQLLLRYEYQKDQSLIGENQYLYDSDWVTGQIKSCIEFWKGEREASYAVEDERWKCRLFKYASNCPVNVTSEEHTTQTTKEA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G422940`
TK1151 ID	TkA02G422940
OH-1004 ID	LXL04_014476
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.700
Protein coverage (%)	TK1151 100.000 / OH-1004 36.765 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G422940

Location Chr02:107392977-107395895 (+)

Description Similar to At5g60370: Exonuclease V, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60370`	Single-stranded DNA (ssDNA) bidirectional exonuclease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014476 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0036297 interstrand cross-link repair Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity Molecular Function

GO:0045145 single-stranded DNA 5'-3' DNA exonuclease activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT5G60370

bta:538883

dre:641427

hsa:64789

mmu:73172

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.574

Rank 1 · TkA02G422940 · TK1151

Cytoplasm0.451

Rank 2 · TkA02G422940 · TK1151

Mitochondrion0.078

Rank 3 · TkA02G422940 · TK1151

Cell membrane0.035

Rank 4 · TkA02G422940 · TK1151

Endoplasmic reticulum0.034

Rank 5 · TkA02G422940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09810Exo51-39 aa

PF01963TraB_PrgY_gumN25-105 aa

PF26222DUF804834-122 aa

PF06265YutD-like39-82 aa

PF09810Exo564-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G422940	`PF09810`	Exo5	1	39	2.7e-10	41.0
TkA02G422940	`PF01963`	TraB_PrgY_gumN	25	105	0.018	15.6
TkA02G422940	`PF26222`	DUF8048	34	122	0.0016	19.0
TkA02G422940	`PF06265`	YutD-like	39	82	0.028	15.2
TkA02G422940	`PF09810`	Exo5	64	133	2.7e-10	41.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKK6`	Arabidopsis thaliana	sp\|Q9FKK6\|EXO5_ARATH Exonuclease V, chloroplastic	45.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card