TkA02G421910 | RubberDandelionOmics

Gene overview

TkA02G421910

Reference: TK1151 Chr: Chr02 Coordinates: 107134543-107137028 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1730 bp · TkA02G421910|TK1151|cDNA

TTTGGTTCCTCAAAACGAAAAAAAAAAGGTCGGTGAAGTGTCGGTAACAAATTATTTCAAAATTTCAATCAATTTTTGTGGTTGGCATGTCCATGTGTCATGATCATCGTCTTCAAAGCTACTGAAATGTTTGCGTCATGTCCAATCCAGTTGGCTCCACTTTAACAATCTAGCACCTTCCATGATTCATACACCCAACCCAACTCCGATCCGTTAATCTCCACCGTCCATTCCATCATCTCCTCCATTTCTCTCATTGA...

CDS

Download CDS FASTA

960 bp · TkA02G421910|TK1151|CDS

ATGGGGGCAAAACAGTTATCCGTTTTGCTAATCGGTATACTGTTTGTAATTGTTTCGATCGCAAATGCCGATTCTTCAGCGGAAGTACTTGTGAAGAAGGTGAAGGGGAAGAAAGTATGCGATAAAGGTTGGGAATGTAAAGGTTGGTCGGAGTATTGCTGTAACCTTACAATTTCCGACTACTTTGACACCTACCAGTTTGAGGAGCTTTTCGCAAAGAGAAATTCTCCGGTGGCAAAAGCCGTCGGTTTCTGGGATTA...

Protein

Download Protein FASTA

319 aa · TkA02G421910|TK1151|PROTEIN

MGAKQLSVLLIGILFVIVSIANADSSAEVLVKKVKGKKVCDKGWECKGWSEYCCNLTISDYFDTYQFEELFAKRNSPVAKAVGFWDYKSFITASALYQPHGFGTTGNKTTQMKEIAAFLGHVGSQTSCGYGVATGGPTAWGLCYNKEMSPPHEYCDDFYKYTYPCAPGAGYYGRGALPIYWQYNYGKIGEALKVDLLNHPELIEQNATLAFQAAIHMWVTPMKKGQPSAHEAFVGTWKPTKNDTLAKRFPGFGTTMNILY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G421910`
TK1151 ID	TkA02G421910
OH-1004 ID	LXL04_004195
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.000
Protein coverage (%)	TK1151 92.163 / OH-1004 73.750 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G421910

Location Chr02:107134543-107137028 (+)

Description Similar to CTL1: Chitinase-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16920`	No chitinase activity (By similarity).	Mutation of the chitinase-like protein-encoding AtCTL2 gene enhances lignin accumulation in dark-grown Arabidopsis seedlings.2010 · DOI: 10.1016/j.jplph.2009.12.001
`At1g05850`	No chitinase activity.	Arabidopsis hot mutants define multiple functions required for acclimation to high temperatures.2003 · DOI: 10.1104/pp.102.017145 Loss-of-function mutations of ROOT HAIR DEFECTIVE3 suppress root waving, skewing, and epidermal cell file rotation in Arabidopsis.2005 · DOI: 10.1104/pp.105.059774 Arabidopsis hot2 encodes an endochitinase-like protein that is essential for tolerance to heat, salt and drought stresses.2007 · DOI: 10.1111/j.1365-313x.2006.02950.x Mutation of the chitinase-like protein-encoding AtCTL2 gene enhances lignin accumulation in dark-grown Arabidopsis seedlings.2010 · DOI: 10.1016/j.jplph.2009.12.001 Structural and genetic analysis of epidermal cell differentiation in Arabidopsis primary roots.1997 · DOI: 10.1242/dev.124.9.1789
`At3g12500`	Defense against chitin-containing fungal pathogens.	No verified direct reference in this release
`At2g43570`	Endochitinase CHI.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004195 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000272 polysaccharide catabolic process Biological Process

GO:0001708 cell fate specification Biological Process

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006032 chitin catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0009825 multidimensional cell growth Biological Process

KEGG gene cross-reference

ath:AT1G05850

ath:AT3G12500

ath:AT3G16920

sly:544146

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.531

Rank 1 · TkA02G421910 · TK1151

Lysosome / Vacuole0.163

Rank 2 · TkA02G421910 · TK1151

Extracellular0.101

Rank 3 · TkA02G421910 · TK1151

Cytoplasm0.095

Rank 4 · TkA02G421910 · TK1151

Endoplasmic reticulum0.089

Rank 5 · TkA02G421910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00182Glyco_hydro_1966-292 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G421910	`PF00182`	Glyco_hydro_19	66	292	1.3e-60	205.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSP9`	Arabidopsis thaliana	sp\|Q9LSP9\|CTL2_ARATH Chitinase-like protein 2	74.100%	Swiss-Prot	High
`Q9MA41`	Arabidopsis thaliana	sp\|Q9MA41\|CTL1_ARATH Chitinase-like protein 1	68.600%	Swiss-Prot	High
`P19171`	Arabidopsis thaliana	sp\|P19171\|CHIB_ARATH Basic endochitinase B	35.800%	Swiss-Prot	Medium
`O24603`	Arabidopsis thaliana	sp\|O24603\|CHI_ARATH Endochitinase CHI	31.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card