RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G416400
Reference: TK1151 Chr: Chr02 Coordinates: 105805968-105806885 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

776 bp · TkA02G416400|TK1151|cDNA

CTCCTTTATAATCTTCCCTCCAACACTCTTCACTCCAGGGCTCCAATTATCATCCCCATTCTTTGATAATAAGCTCTGTTCATCATCAATGGCGTCGCCGCCGGACACCAGTAAAACAACCAAGCTCGAACGCTATAACAGCTACATAAGGAGAGTCAATAGCACAAAGCTCTTAGCGGCTTCTTCCAAGCTTCTCTTTCGTGTTACCCTTTTGGTTGCTTTGGTCTTGATCTTTTTCTTTACGTTTAATTACCCTCCGC...

CDS

Download CDS FASTA

312 bp · TkA02G416400|TK1151|CDS

ATGGCGTCGCCGCCGGACACCAGTAAAACAACCAAGCTCGAACGCTATAACAGCTACATAAGGAGAGTCAATAGCACAAAGCTCTTAGCGGCTTCTTCCAAGCTTCTCTTTCGTGTTACCCTTTTGGTTGCTTTGGTCTTGATCTTTTTCTTTACGTTTAATTACCCTCCGCTTGCCGATAACGCTTCTCCCGCCGGCCACCATGTTCATACCACGTCCCACCTTCTGTCCTCCGCGTTTTACGGTAGTGGTGCGTCGTG...

Protein

Download Protein FASTA

103 aa · TkA02G416400|TK1151|PROTEIN

MASPPDTSKTTKLERYNSYIRRVNSTKLLAASSKLLFRVTLLVALVLIFFFTFNYPPLADNASPAGHHVHTTSHLLSSAFYGSGASWEKEVRRSSTPRRPNGF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G416400
TK1151 IDTkA02G416400
OH-1004 IDLXL04_014531
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 23.043
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G416400
LocationChr02:105805968-105806885 (-)
DescriptionSimilar to GAE6: UDP-glucuronate 4-epimerase 6
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g23820 Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.
Identification and characterization of a UDP-D-glucuronate 4-epimerase in Arabidopsis.2004 · DOI: 10.1016/j.febslet.2004.06.005

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_014531 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0033481 galacturonate biosynthetic process Biological Process
GO:0050829 defense response to Gram-negative bacterium Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0000138 Golgi trans cisterna Cellular Component
GO:0005768 endosome Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005797 Golgi medial cisterna Cellular Component
GO:0005802 trans-Golgi network Cellular Component
GO:0016020 membrane Cellular Component
GO:0032580 Golgi cisterna membrane Cellular Component
GO:0016854 racemase and epimerase activity Molecular Function
GO:0050378 UDP-glucuronate 4-epimerase activity Molecular Function
KEGG gene cross-reference
ath:AT1G02000
ath:AT2G45310
ath:AT3G23820
ath:AT4G00110
ath:AT4G12250
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.428
Rank 1 · TkA02G416400 · TK1151
Nucleus0.331
Rank 2 · TkA02G416400 · TK1151
Cytoplasm0.127
Rank 3 · TkA02G416400 · TK1151
Golgi apparatus0.112
Rank 4 · TkA02G416400 · TK1151
Cell membrane0.105
Rank 5 · TkA02G416400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LIS3Arabidopsis thalianasp|Q9LIS3|GAE6_ARATH UDP-glucuronate 4-epimerase 654.500%Swiss-ProtHigh

JBrowse

View in Genome Browser