TkA02G414950 | RubberDandelionOmics

Gene overview

TkA02G414950

Reference: TK1151 Chr: Chr02 Coordinates: 105487117-105495700 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · TkA02G414950|TK1151|cDNA

CCGAGTCACCCACCAATAAATTCTTTCCCGAAATCAAAAATTTATTCTGAATTAAATCGGGATCATGTGCTGCAGCCATGGATTTATCTCAAAAATCCCCACCACACCCCCACCTCTCGTTTCTCGACGAACCCATTTCGCAATTCCATCCACAATTCGTCTACCTATAGCCACTGGAAGCGCCAGATCTTTCAGAACGAAATCGGCGGCGGCGGCCGTTAAAGATGGCGGCAGTTCTGTATCGGAGTCGCCTGTCATGG...

CDS

Download CDS FASTA

603 bp · TkA02G414950|TK1151|CDS

ATGTGCTGCAGCCATGGATTTATCTCAAAAATCCCCACCACACCCCCACCTCTCGTTTCTCGACGAACCCATTTCGCAATTCCATCCACAATTCGTCTACCTATAGCCACTGGAAGCGCCAGATCTTTCAGAACGAAATCGGCGGCGGCGGCCGTTAAAGATGGCGGCAGTTCTGTATCGGAGTCGCCTGTCATGGAAGATCTGAGCTTCTACGAGCTTCTGGGTATCCCGGAAACGGTGACATCTGTGGAAATCAAGCA...

Protein

Download Protein FASTA

200 aa · TkA02G414950|TK1151|PROTEIN

MCCSHGFISKIPTTPPPLVSRRTHFAIPSTIRLPIATGSARSFRTKSAAAAVKDGGSSVSESPVMEDLSFYELLGIPETVTSVEIKQAYKQLARKYHPDVSPPGRAEEYTQRFIRVQEAYETLSDPSRRAMYDRDMAMGIHFAFSSRNHSRNDENMVKSEWRGQWQSQLSGLRRRSMHKESGKNSSWAARMRKQREECSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G414950`
TK1151 ID	TkA02G414950
OH-1004 ID	LXL04_014545
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G414950

Location Chr02:105487117-105495700 (+)

Description Similar to ATJ20: Chaperone protein dnaJ 20, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13830`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014545 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006457 protein folding Biological Process

GO:0009408 response to heat Biological Process

GO:0010322 regulation of isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway Biological Process

GO:0042026 protein refolding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0031072 heat shock protein binding Molecular Function

GO:0051082 unfolded protein binding Molecular Function

KEGG gene cross-reference

ath:AT4G13830

tma:TM0849

tmi:THEMA_00395

tmm:Tmari_0851

tmw:THMA_0870

tna:CTN_1726

tpt:Tpet_0078

trq:TRQ2_0078

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.788

Rank 1 · TkA02G414950 · TK1151

Nucleus0.117

Rank 2 · TkA02G414950 · TK1151

Mitochondrion0.093

Rank 3 · TkA02G414950 · TK1151

Cytoplasm0.030

Rank 4 · TkA02G414950 · TK1151

Cell membrane0.014

Rank 5 · TkA02G414950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226DnaJ70-133 aa

PF30912TIM141_C72-100 aa

PF23083FF_RHG35_4th85-134 aa

PF04949Transcrip_act104-130 aa

PF04949Transcrip_act151-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G414950	`PF00226`	DnaJ	70	133	5.7e-22	78.3
TkA02G414950	`PF30912`	TIM141_C	72	100	0.13	13.0
TkA02G414950	`PF23083`	FF_RHG35_4th	85	134	0.11	13.5
TkA02G414950	`PF04949`	Transcrip_act	104	130	0.048	14.3
TkA02G414950	`PF04949`	Transcrip_act	151	160	0.048	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SDN0`	Arabidopsis thaliana	sp\|Q9SDN0\|DNJ20_ARATH Chaperone protein dnaJ 20, chloroplastic	68.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card