TkA02G403840 | RubberDandelionOmics

Gene overview

TkA02G403840

Reference: TK1151 Chr: Chr02 Coordinates: 102585228-102586343 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1008 bp · TkA02G403840|TK1151|cDNA

ATGTCACAAAAGGTGCAAGACGATTCCGTCAAACTCCCACCACCGTACGTTCATCCACTGGTTAAGAAGTCTGCTAGCTCATTGAGCGAGAAAAGTCTTAAAGTTTGTACTGAGAGTCTCGGGTCCGAGACTGGATCAGATGTGTTCTCGTCGTATCCGTCTTCAGAGGCCAGTGACGAGAACAAGGTTCAAGAGAACCAAGAAGAAAATGAGGAGATAAAAGAGGCGGATGCGGAAGAACAGAAAGTTGTCAAGCATGC...

CDS

Download CDS FASTA

1008 bp · TkA02G403840|TK1151|CDS

ATGTCACAAAAGGTGCAAGACGATTCCGTCAAACTCCCACCACCGTACGTTCATCCACTGGTTAAGAAGTCTGCTAGCTCATTGAGCGAGAAAAGTCTTAAAGTTTGTACTGAGAGTCTCGGGTCCGAGACTGGATCAGATGTGTTCTCGTCGTATCCGTCTTCAGAGGCCAGTGACGAGAACAAGGTTCAAGAGAACCAAGAAGAAAATGAGGAGATAAAAGAGGCGGATGCGGAAGAACAGAAAGTTGTCAAGCATGC...

Protein

Download Protein FASTA

335 aa · TkA02G403840|TK1151|PROTEIN

MSQKVQDDSVKLPPPYVHPLVKKSASSLSEKSLKVCTESLGSETGSDVFSSYPSSEASDENKVQENQEENEEIKEADAEEQKVVKHATCLTTKKTQQTRSLPPPLSSLSTARNDGPSLHMHSHRVDGRLVLEAVSVPQQNYFEAQRQDGRFLLTLINNPKEDEDEIESNFGDKEMGILKVRPSNLASGVIKLKGSMVSIKRIRERDNENPLWSRKLNEKTTKLQVVEEEEASATNPSASPIKKYVPQPPRASGLPPLPRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G403840`
TK1151 ID	TkA02G403840
OH-1004 ID	LXL04_014707
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.700
Protein coverage (%)	TK1151 100.000 / OH-1004 76.531 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G403840

Location Chr02:102585228-102586343 (+)

Description Similar to At5g22090: Protein FAF-like, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22090`	Protein FAF-like, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014707 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0042326 negative regulation of phosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0019902 phosphatase binding Molecular Function

GO:0072542 protein phosphatase activator activity Molecular Function

KEGG gene cross-reference

ath:AT1G03170

ath:AT3G06020

ath:AT5G19260

ath:AT5G22090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.406

Rank 1 · TkA02G403840 · TK1151

Cytoplasm0.389

Rank 2 · TkA02G403840 · TK1151

Cell membrane0.340

Rank 3 · TkA02G403840 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA02G403840 · TK1151

Plastid0.059

Rank 5 · TkA02G403840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15624Mif2_N41-110 aa

PF11250FAF100-155 aa

PF15624Mif2_N222-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G403840	`PF15624`	Mif2_N	41	110	0.06	14.7
TkA02G403840	`PF11250`	FAF	100	155	2.7e-20	73.0
TkA02G403840	`PF15624`	Mif2_N	222	250	0.06	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0V865`	Arabidopsis thaliana	sp\|Q0V865\|FAFL_ARATH Protein FAF-like, chloroplastic	32.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card