TkA02G401950 | RubberDandelionOmics

Gene overview

TkA02G401950

Reference: TK1151 Chr: Chr02 Coordinates: 102050572-102052522 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

991 bp · TkA02G401950|TK1151|cDNA

CTTATCCTCACCGTCTCCTCCCAACTTTCTAAGCTCTCTTTTTTCCCTTTAACAGCCAGAAAACCTCTTTTCACCCTCCGCAACTCCTCCTCCACCCCCAAAATCATGAGCCGGCAGGCAGGCTATGGTTCGGTACTCGTCCGCCCAGCCGGCGCATCCATGGATCAATCATCTATTGCTCAGGGAGCCTACGATGAACTGCCGGCCCGCGGTCAACAGTTCATCAGGGGAATAATGTTGGAACACAATATAGATTTGAA...

CDS

Download CDS FASTA

312 bp · TkA02G401950|TK1151|CDS

ATGAGTGAACGAAAAAACAGGATTCAACGGTTGACATGTCAAAAGATGCTGAAACAAAATGGAATTACCACTTCACCTGATAAAAAAAACCATGAAATTTCAGGGGATTTATTTGACAAAATGTCTTTCAAGAAAGATAATTTTGTTCAAAGTTGGTCCACTTCAGGGGAAAAGTACGATACGATTCTTTGCCTAAGTGTTACAAAATGGGTCCACTTGAATTGGGGTGATGACGGCTTAACAGTGTTTTCAAAGGTTTA...

Protein

Download Protein FASTA

103 aa · TkA02G401950|TK1151|PROTEIN

MSERKNRIQRLTCQKMLKQNGITTSPDKKNHEISGDLFDKMSFKKDNFVQSWSTSGEKYDTILCLSVTKWVHLNWGDDGLTVFSKVYRLLEPVTFMVLLVILL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G401950`
TK1151 ID	TkA02G401950
OH-1004 ID	LXL04_027955
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	71.600
Protein coverage (%)	TK1151 89.320 / OH-1004 33.569 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G401950

Location Chr02:102050572-102052522 (-)

Description Similar to At5g51130: Probable RNA methyltransferase At5g51130

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51130`	Probable RNA methyltransferase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027955 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0001510 RNA methylation Biological Process

GO:0016073 snRNA metabolic process Biological Process

GO:0032259 methylation Biological Process

GO:0040031 snRNA modification Biological Process

GO:1900087 positive regulation of G1/S transition of mitotic cell cycle Biological Process

GO:1904871 positive regulation of protein localization to Cajal body Biological Process

GO:1905382 positive regulation of snRNA transcription by RNA polymerase II Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G51130

cel:CELE_Y17G7B.18

hsa:56257

mmu:231803

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.395

Rank 1 · TkA02G401950 · TK1151

Cytoplasm0.377

Rank 2 · TkA02G401950 · TK1151

Mitochondrion0.132

Rank 3 · TkA02G401950 · TK1151

Extracellular0.079

Rank 4 · TkA02G401950 · TK1151

Endoplasmic reticulum0.078

Rank 5 · TkA02G401950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08242Methyltransf_1213-22 aa

PF11123DNA_Packaging_215-43 aa

PF06859Bin332-32 aa

PF13489Methyltransf_2334-101 aa

PF08242Methyltransf_1238-92 aa

PF06859Bin359-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G401950	`PF08242`	Methyltransf_12	13	22	0.065	14.7
TkA02G401950	`PF11123`	DNA_Packaging_2	15	43	0.17	12.7
TkA02G401950	`PF06859`	Bin3	32	32	1.7e-13	51.8
TkA02G401950	`PF13489`	Methyltransf_23	34	101	0.021	15.2
TkA02G401950	`PF08242`	Methyltransf_12	38	92	0.065	14.7
TkA02G401950	`PF06859`	Bin3	59	98	1.7e-13	51.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NPC9`	Arabidopsis thaliana	sp\|Q6NPC9\|BIN3D_ARATH Probable RNA methyltransferase At5g51130	67.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card