TkA02G398840 | RubberDandelionOmics

Gene overview

TkA02G398840

Reference: TK1151 Chr: Chr02 Coordinates: 101317515-101321329 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3031 bp · TkA02G398840|TK1151|cDNA

GTAAAAAAGGTTTTTACTTGTTATTTAAAAAACCCTACTCTTCTTCCTTCTTTCTTCCCCCGTCTTTCTCTCTCAAATAATCAAAGCTTTTCTTCTGGAGAGAGAAAGTTGAAGAGAACAACCCCTTTTCAAAGGGTAGTTCAGTAGCGAGTGACCTCCATGGATACAATCGAAGCTACTAAAATGGTGATGGAGAGAATCCAAAACATAGATCCAGTAAACGCTTCGAAAATCATGGGTTATATACTCATACAAGACCA...

CDS

Download CDS FASTA

1494 bp · TkA02G398840|TK1151|CDS

ATGGACCCGATCGTGAGTCCTGGCGGCCGGAGCGACTCGATTCTCTTCCCGTACCCGAATAGCACCACTGATTGGTCTGCAGATGGAAACAGTTGCGGCGATGCGCACAACCACTTCCACAGGAGAAGTTGCTCGGTTAATGATATGTTTTTCGGCGGTGGTACTGGAAACGACGATTTGGGTAATGGATTAGGCGGGTGGAGGCCATGCATGTACTACGCTCGAGGGTTTTGCAAAAACGGCACTTCTTGCAAGTTCAT...

Protein

Download Protein FASTA

497 aa · TkA02G398840|TK1151|PROTEIN

MDPIVSPGGRSDSILFPYPNSTTDWSADGNSCGDAHNHFHRRSCSVNDMFFGGGTGNDDLGNGLGGWRPCMYYARGFCKNGTSCKFIHGNGDEMCLGSSSPTAIAGSPTGNIDGFEDFLRIKAIQQQQRVAAMAAGGPHPFSFNRCMNFLNDSPRSPSSAAAALMMGEDFHKYGRFRPDRHDLMGLGNSNSSSRQIYLTFPADSTFKEEDVSNYFSIFGPVQDVRIPYQQKRMFGFVTFVLPETVKAILAKGNPHFVCDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G398840`
TK1151 ID	TkA02G398840
OH-1004 ID	LXL04_014770
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 74.218 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G398840

Location Chr02:101317515-101321329 (-)

Description Similar to Os03g0328900: Zinc finger CCCH domain-containing protein 22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g12440`	Zinc finger CCCH domain-containing protein 55.	No verified direct reference in this release
`At3g51950`	Possesses RNA-binding and ribonuclease activities in vitro.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0328900`	Zinc finger CCCH domain-containing protein 22.	No verified direct reference in this release
`Os07g0682400`	Zinc finger CCCH domain-containing protein 53.	No verified direct reference in this release
`Os03g0329200`	Zinc finger CCCH domain-containing protein 23.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014770 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0004518 nuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT3G51950

ath:AT5G12440

dosa:Os03g0328900

dosa:Os03g0329200

dosa:Os07g0682400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.812

Rank 1 · TkA02G398840 · TK1151

Cytoplasm0.266

Rank 2 · TkA02G398840 · TK1151

Cell membrane0.051

Rank 3 · TkA02G398840 · TK1151

Endoplasmic reticulum0.025

Rank 4 · TkA02G398840 · TK1151

Plastid0.014

Rank 5 · TkA02G398840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18345zf_CCCH_438-44 aa

PF00642zf-CCCH68-89 aa

PF18044zf-CCCH_468-88 aa

PF16131Torus69-88 aa

PF14608zf-CCCH_269-89 aa

PF18345zf_CCCH_470-88 aa

PF08675RNA_bind196-222 aa

PF00076RRM_1206-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G398840	`PF18345`	zf_CCCH_4	38	44	0.002	18.8
TkA02G398840	`PF00642`	zf-CCCH	68	89	7.3e-07	29.7
TkA02G398840	`PF18044`	zf-CCCH_4	68	88	0.0033	17.9
TkA02G398840	`PF16131`	Torus	69	88	0.00033	21.9
TkA02G398840	`PF14608`	zf-CCCH_2	69	89	0.0026	18.9
TkA02G398840	`PF18345`	zf_CCCH_4	70	88	0.002	18.8
TkA02G398840	`PF08675`	RNA_bind	196	222	0.15	12.9
TkA02G398840	`PF00076`	RRM_1	206	253	1.6e-06	28.6
TkA02G398840	`PF00076`	RRM_1	322	341	1.6e-06	28.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94CJ8`	Arabidopsis thaliana	sp\|Q94CJ8\|C3H55_ARATH Zinc finger CCCH domain-containing protein 55	43.900%	Swiss-Prot	Medium
`Q9SV09`	Arabidopsis thaliana	sp\|Q9SV09\|C3H46_ARATH Zinc finger CCCH domain-containing protein 46	49.200%	Swiss-Prot	Medium
`Q10M00`	Oryza sativa subsp. japonica	sp\|Q10M00\|C3H22_ORYSJ Zinc finger CCCH domain-containing protein 22	42.900%	Swiss-Prot	Medium
`Q0D3J9`	Oryza sativa subsp. japonica	sp\|Q0D3J9\|C3H53_ORYSJ Zinc finger CCCH domain-containing protein 53	42.500%	Swiss-Prot	Medium
`Q10LZ9`	Oryza sativa subsp. japonica	sp\|Q10LZ9\|C3H23_ORYSJ Zinc finger CCCH domain-containing protein 23	43.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card