TkA02G397350 | RubberDandelionOmics

Gene overview

TkA02G397350

Reference: TK1151 Chr: Chr02 Coordinates: 100936226-100945846 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1419 bp · TkA02G397350|TK1151|cDNA

ATGCCGCCAAGACAAATGAGTGACTTTGACCGAGTCATGGCTCGGAAAAAGAAAAAGCATGGCGACCCATCGGGGGATGGTAGACCTCCATTCCTCTCTGCTTTCAGGAGGGAGGCAATCAGACGACACTTGCACAATCGGGACACGTATCCAACCCGATTCTACCACGAGGCCACCATGACAAGGCTTTTCGCACACCTGTTGATCGTCACCATGTTTCGAAACATTGGATGGGAGAACTTTCTAAACAGAAGTGCAAT...

CDS

Download CDS FASTA

1419 bp · TkA02G397350|TK1151|CDS

ATGCCGCCAAGACAAATGAGTGACTTTGACCGAGTCATGGCTCGGAAAAAGAAAAAGCATGGCGACCCATCGGGGGATGGTAGACCTCCATTCCTCTCTGCTTTCAGGAGGGAGGCAATCAGACGACACTTGCACAATCGGGACACGTATCCAACCCGATTCTACCACGAGGCCACCATGACAAGGCTTTTCGCACACCTGTTGATCGTCACCATGTTTCGAAACATTGGATGGGAGAACTTTCTAAACAGAAGTGCAAT...

Protein

Download Protein FASTA

472 aa · TkA02G397350|TK1151|PROTEIN

MPPRQMSDFDRVMARKKKKHGDPSGDGRPPFLSAFRREAIRRHLHNRDTYPTRFYHEATMTRLFAHLLIVTMFRNIGWENFLNRSAISYPNLTMEFLSTYAYDVEQRRLTFDLLEQNYMLTFEQVNDAMGVDLTQGPLADRFSLAYYEFKKEAKTQFYKLISRDTGDFNSQKRDYWVVHPIWVLAHRIISSSLTSRRETGQLNSNELFIMYCMYKKLPVDFCDFFLERCDLIRKRRAGDVGVGGLVTIIAQAVNLDLANV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G397350`
TK1151 ID	TkA02G397350
OH-1004 ID	LXL04_037386
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.700
Protein coverage (%)	TK1151 94.915 / OH-1004 94.572 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G397350`
Location	Chr02:100936226-100945846 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037386` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.929

Rank 1 · TkA02G397350 · TK1151

Cytoplasm0.245

Rank 2 · TkA02G397350 · TK1151

Mitochondrion0.020

Rank 3 · TkA02G397350 · TK1151

Cell membrane0.018

Rank 4 · TkA02G397350 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA02G397350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15699NPR1_interact5-22 aa

PF03078ATHILA42-209 aa

PF20167Retrotransp-rel75-221 aa

PF20631CoV_NSP13_1B136-158 aa

PF20631CoV_NSP13_1B184-231 aa

PF03078ATHILA233-363 aa

PF15699NPR1_interact321-377 aa

PF23067MG280369-423 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G397350	`PF15699`	NPR1_interact	5	22	0.77	11.1
TkA02G397350	`PF03078`	ATHILA	42	209	1.6e-07	31.3
TkA02G397350	`PF20167`	Retrotransp-rel	75	221	0.00031	21.4
TkA02G397350	`PF20631`	CoV_NSP13_1B	136	158	0.11	13.5
TkA02G397350	`PF20631`	CoV_NSP13_1B	184	231	0.11	13.5
TkA02G397350	`PF03078`	ATHILA	233	363	1.6e-07	31.3
TkA02G397350	`PF15699`	NPR1_interact	321	377	0.77	11.1
TkA02G397350	`PF23067`	MG280	369	423	0.3	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card