TkA02G386850 | RubberDandelionOmics

Gene overview

TkA02G386850

Reference: TK1151 Chr: Chr02 Coordinates: 98309324-98312764 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

717 bp · TkA02G386850|TK1151|cDNA

ATGGGGACGCTTTCAACACTAAAAACTGCACTAGAGTCGCTTACAGGTGGTGGAGACGACATAATGGGGAAAATTATTGAGATTTGGGGCCTAGTCAAAGTGCCAGTTTTGGTGCCATTGTTGAGAATGCTGATGTATATTTCTCTTGTGATGTCCATGATGCTGTTCATTGAGATCGTTTACATGTCGTTGGTGATTGCATTCAATTATTTGTTTGGGAGAAAGACAGAAAAACGTTACAAATGGGAAGAATTTAAAGA...

CDS

Download CDS FASTA

717 bp · TkA02G386850|TK1151|CDS

ATGGGGACGCTTTCAACACTAAAAACTGCACTAGAGTCGCTTACAGGTGGTGGAGACGACATAATGGGGAAAATTATTGAGATTTGGGGCCTAGTCAAAGTGCCAGTTTTGGTGCCATTGTTGAGAATGCTGATGTATATTTCTCTTGTGATGTCCATGATGCTGTTCATTGAGATCGTTTACATGTCGTTGGTGATTGCATTCAATTATTTGTTTGGGAGAAAGACAGAAAAACGTTACAAATGGGAAGAATTTAAAGA...

Protein

Download Protein FASTA

238 aa · TkA02G386850|TK1151|PROTEIN

MGTLSTLKTALESLTGGGDDIMGKIIEIWGLVKVPVLVPLLRMLMYISLVMSMMLFIEIVYMSLVIAFNYLFGRKTEKRYKWEEFKDDVELGNSVYPLVLIQIPMFNEKKVYQLSIGAACRLSWPADRIVIQVLDDSTDAVVKGMVEGECEKWACKGTNIRYQVRDNRKGYKGGALKEGLQHDYANECDYVAIFDADFQPEPDFLWKTIPFLHHNPELGLVQARWKFGKRFYKLIWFP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G386850`
TK1151 ID	TkA02G386850
OH-1004 ID	LXL04_014885
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G386850

Location Chr02:98309324-98312764 (-)

Description Similar to CSLA9: Glucomannan 4-beta-mannosyltransferase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03760`	Possesses glucomannan synthase and mannan synthase activities in vitro.	Agrobacterium-mediated root transformation is inhibited by mutation of an Arabidopsis cellulose synthase-like gene.2003 · DOI: 10.1104/pp.103.030726
`At5g22740`	Possesses glucomannan synthase and mannan synthase activities in vitro.	No verified direct reference in this release
`At2g35650`	Probable mannan synthase which consists of a 4-beta-mannosyltransferase activity on mannan using GDP-mannose.	AtCSLA7, a cellulose synthase-like putative glycosyltransferase, is important for pollen tube growth and embryogenesis in Arabidopsis.2003 · DOI: 10.1104/pp.014555

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0192500`	Possesses glucomannan synthase and mannan synthase activities in vitro.	No verified direct reference in this release
`Os06g0625700`	Probable mannan synthase which consists of a 4-beta-mannosyltransferase activity on mannan using GDP-mannose.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014885 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009294 DNA-mediated transformation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010192 mucilage biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0047259 glucomannan 4-beta-mannosyltransferase activity Molecular Function

GO:0051753 mannan synthase activity Molecular Function

KEGG gene cross-reference

ath:AT1G23480

ath:AT2G35650

ath:AT5G03760

ath:AT5G22740

dosa:Os06g0625700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.304

Rank 1 · TkA02G386850 · TK1151

Golgi apparatus0.291

Rank 2 · TkA02G386850 · TK1151

Plastid0.109

Rank 3 · TkA02G386850 · TK1151

Cell membrane0.098

Rank 4 · TkA02G386850 · TK1151

Cytoplasm0.091

Rank 5 · TkA02G386850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13641Glyco_tranf_2_399-223 aa

PF00535Glycos_transf_2103-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G386850	`PF13641`	Glyco_tranf_2_3	99	223	0.0019	18.7
TkA02G386850	`PF00535`	Glycos_transf_2	103	229	1.7e-10	41.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZR3`	Arabidopsis thaliana	sp\|Q9LZR3\|CSLA9_ARATH Glucomannan 4-beta-mannosyltransferase 9	64.400%	Swiss-Prot	High
`Q9FNI7`	Arabidopsis thaliana	sp\|Q9FNI7\|CSLA2_ARATH Glucomannan 4-beta-mannosyltransferase 2	63.400%	Swiss-Prot	High
`Q9ZQN8`	Arabidopsis thaliana	sp\|Q9ZQN8\|CSLA7_ARATH Glucomannan 4-beta-mannosyltransferase 7	56.500%	Swiss-Prot	High
`Q7PC76`	Oryza sativa subsp. japonica	sp\|Q7PC76\|CSLA1_ORYSJ Glucomannan 4-beta-mannosyltransferase 1	61.900%	Swiss-Prot	High
`Q67VS7`	Oryza sativa subsp. japonica	sp\|Q67VS7\|CSLA9_ORYSJ Probable glucomannan 4-beta-mannosyltransferase 9	56.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card