TkA02G386110 | RubberDandelionOmics

Gene overview

TkA02G386110

Reference: TK1151 Chr: Chr02 Coordinates: 98139935-98140630 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

666 bp · TkA02G386110|TK1151|cDNA

ATGGCAGCCGCTGCAGCTTCGTTTGCCTTCTCAAGACTCGTCACCTCCGCCACTAAACCCCACTTCACCCACCGCTCTATCAGCTTCTCTTCATCCATCTCCCCCCTCCGCATCAAAAACCTCCGCCTCGCCCGCCATAACCCCATCAAATACTCCACAACTCCCAAAATCACCGCCACCATTTCCGTCGGAGACAAACTACCCGACGCTACCTTATCCTACTTCGACTCCGACGGCGAACTCCAAACCACCACCATCTC...

CDS

Download CDS FASTA

666 bp · TkA02G386110|TK1151|CDS

ATGGCAGCCGCTGCAGCTTCGTTTGCCTTCTCAAGACTCGTCACCTCCGCCACTAAACCCCACTTCACCCACCGCTCTATCAGCTTCTCTTCATCCATCTCCCCCCTCCGCATCAAAAACCTCCGCCTCGCCCGCCATAACCCCATCAAATACTCCACAACTCCCAAAATCACCGCCACCATTTCCGTCGGAGACAAACTACCCGACGCTACCTTATCCTACTTCGACTCCGACGGCGAACTCCAAACCACCACCATCTC...

Protein

Download Protein FASTA

221 aa · TkA02G386110|TK1151|PROTEIN

MAAAAASFAFSRLVTSATKPHFTHRSISFSSSISPLRIKNLRLARHNPIKYSTTPKITATISVGDKLPDATLSYFDSDGELQTTTISDLTKSKKAILFAVPGAFTPTCSQKHLPGFVEKSSELKSKGVDTIACISVNDAFVMKAWKADLKIGDEVLLLSDGNGDFTKAIGCELDLSDKPIGLGVRSRRFAMLVEDGVVKVLNLEEGGAFTSSGAEDMLKAL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G386110`
TK1151 ID	TkA02G386110
OH-1004 ID	LXL04_014893
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G386110

Location Chr02:98139935-98140630 (-)

Description Similar to PRXIIE: Peroxiredoxin-2E, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52960`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release
`At1g65980`	Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system.	No verified direct reference in this release
`At1g60740`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0625500`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release
`Os02g0192700`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014893 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0034599 cellular response to oxidative stress Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT1G60740

ath:AT1G65980

ath:AT3G52960

dosa:Os02g0192700

dosa:Os06g0625500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.972

Rank 1 · TkA02G386110 · TK1151

Mitochondrion0.065

Rank 2 · TkA02G386110 · TK1151

Cytoplasm0.025

Rank 3 · TkA02G386110 · TK1151

Nucleus0.014

Rank 4 · TkA02G386110 · TK1151

Peroxisome0.012

Rank 5 · TkA02G386110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08534Redoxin63-217 aa

PF00578AhpC-TSA63-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G386110	`PF08534`	Redoxin	63	217	2e-35	122.5
TkA02G386110	`PF00578`	AhpC-TSA	63	198	3.4e-14	53.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949U7`	Arabidopsis thaliana	sp\|Q949U7\|PRX2E_ARATH Peroxiredoxin-2E, chloroplastic	67.700%	Swiss-Prot	High
`Q9XEX2`	Arabidopsis thaliana	sp\|Q9XEX2\|PRX2B_ARATH Peroxiredoxin-2B	58.900%	Swiss-Prot	High
`O22711`	Arabidopsis thaliana	sp\|O22711\|PRX2D_ARATH Peroxiredoxin-2D	55.800%	Swiss-Prot	High
`Q69TY4`	Oryza sativa subsp. japonica	sp\|Q69TY4\|PR2E1_ORYSJ Peroxiredoxin-2E-1, chloroplastic	74.300%	Swiss-Prot	High
`Q7F8S5`	Oryza sativa subsp. japonica	sp\|Q7F8S5\|PR2E2_ORYSJ Peroxiredoxin-2E-2, chloroplastic	74.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card