TkA02G384440 | RubberDandelionOmics

Gene overview

TkA02G384440

Reference: TK1151 Chr: Chr02 Coordinates: 97715904-97719494 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1587 bp · TkA02G384440|TK1151|cDNA

CTAATATAAGAACGACAACCACACATGATTGGTGGGGATGAGAGGGTACCTACTACCTATCTTTAGATGCGCGCCTTTTGTATTATCTGCTACGCTGGTGATTCATGTGACCAACATCCACGTGTTTGTACTGAAAGTCTAAACTGCCCACTTTACCAAACCAATTCGAAAATCCCGAGATGGAAATCCCAGATGGAGAAACACCGCCGCCCACCGGCAACGCTGCCAGGCTTGCGATCATGGAGCTAGCAAACATGATC...

CDS

Download CDS FASTA

696 bp · TkA02G384440|TK1151|CDS

ATGAAGGCGTGGGCGGTGGTGCACGAGGCGGTGGTGGATTCATCGACGGAGCCTTTCGTGAAGGCGAACGGCGGCGAGACAGCTTACGGAATGTACGGGAAGAAACCGGAGATGAACGATCTGATGTTGAAGGCAATGTCGGGGGTCACGGTGCCGTTTATGAAGGCGGTTCTTGAAGGTTACGATGGGTTTAAAGGTGTTGAACGATTGGTGGATGTGGGTGGCAGCGCCGGAGATTGCCTGAGGATGATTTTAGAGAA...

Protein

Download Protein FASTA

231 aa · TkA02G384440|TK1151|PROTEIN

MKAWAVVHEAVVDSSTEPFVKANGGETAYGMYGKKPEMNDLMLKAMSGVTVPFMKAVLEGYDGFKGVERLVDVGGSAGDCLRMILEKHPHIKEGVNFDLPEVVAKAPNIDGVSHVGGDMFTSIPKGDAIFMKWVLTTWTDDEVKAIMINCFKAIPIGGKLVACEPVLPDQTNDSHRTRALLEGDIFVMTIYRAKGKHRTEQEYCQLGKSAGFTTFRSIYVDDFYTLLEFGK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G384440`
TK1151 ID	TkA02G384440
OH-1004 ID	LXL04_036781
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	45.700
Protein coverage (%)	TK1151 99.134 / OH-1004 62.466 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G384440

Location Chr02:97715904-97719494 (+)

Description Similar to COMT1: Caffeic acid 3-O-methyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53140`	Involved in nicotinate detoxification in planta.	A Novel N-Methyltransferase in Arabidopsis Appears to Feed a Conserved Pathway for Nicotinate Detoxification among Land Plants and Is Associated with Lignin Biosynthesis.2017 · DOI: 10.1104/pp.17.00259

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0823400`	Involved in nicotinate detoxification in planta.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036781 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0010555 response to mannitol Biological Process

GO:0030187 melatonin biosynthetic process Biological Process

GO:0031537 regulation of anthocyanin metabolic process Biological Process

GO:0032259 methylation Biological Process

GO:0042428 serotonin metabolic process Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0051555 flavonol biosynthetic process Biological Process

GO:0090333 regulation of stomatal closure Biological Process

KEGG gene cross-reference

ath:AT5G54160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.828

Rank 1 · TkA02G384440 · TK1151

Nucleus0.243

Rank 2 · TkA02G384440 · TK1151

Mitochondrion0.056

Rank 3 · TkA02G384440 · TK1151

Cell membrane0.045

Rank 4 · TkA02G384440 · TK1151

Peroxisome0.045

Rank 5 · TkA02G384440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00891Methyltransf_24-212 aa

PF08557Lipid_DES82-93 aa

PF08557Lipid_DES171-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G384440	`PF00891`	Methyltransf_2	4	212	1.8e-43	149.0
TkA02G384440	`PF08557`	Lipid_DES	82	93	3.0	8.1
TkA02G384440	`PF08557`	Lipid_DES	171	178	3.0	8.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCP7`	Arabidopsis thaliana	sp\|Q9SCP7\|NAMT1_ARATH Nicotinate N-methyltransferase 1	73.600%	Swiss-Prot	High
`Q6K9X3`	Oryza sativa subsp. japonica	sp\|Q6K9X3\|NAMT1_ORYSJ Nicotinate N-methyltransferase 1	61.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card