TkA02G384030 | RubberDandelionOmics

Gene overview

TkA02G384030

Reference: TK1151 Chr: Chr02 Coordinates: 97586928-97590556 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1521 bp · TkA02G384030|TK1151|cDNA

TATGTTGATGAATTCTAAGCTCAAAATTGTTTTCACCTCCTCTCTCTTCCTTTCTCTCTCTCTACGAACTTTTTTCTCTCTTGAGAATTCTCTCTGCAAGTTCTTCCGATCGGCAAATAAACACCATCCAAGACGAGTTCTGGAGTTCAATTTCCATTGTTGCACATTTGTTCGAATTCGCAATGCAGCAATTGGTGCCGCCATGGCTAGACAAGCTTCTAGGAACTGCATTTTTCTCGGTATGCCGGACGCACGGTGCG...

CDS

Download CDS FASTA

621 bp · TkA02G384030|TK1151|CDS

ATGCAGCAATTGGTGCCGCCATGGCTAGACAAGCTTCTAGGAACTGCATTTTTCTCGGTATGCCGGACGCACGGTGCGGCGGCGAGAAGCGAATGTAATATGTTTTGTTTGGATTGCAATAGCGACGCATTTTGCTTCTATTGCCGATCTTCTCGCCATAAAGAACATCAAGTTATTCAGATCAGAAGATCATCTTATCACGATGTCGTAAGAGTTTCAGAGATCGAAAAAGTGTTGAATATCAATGGAGTTCAAACGTA...

Protein

Download Protein FASTA

206 aa · TkA02G384030|TK1151|PROTEIN

MQQLVPPWLDKLLGTAFFSVCRTHGAAARSECNMFCLDCNSDAFCFYCRSSRHKEHQVIQIRRSSYHDVVRVSEIEKVLNINGVQTYVINSARVLFLNERPQPKSGKAVSHICEICGRSLLDALRFCSLGCKVVGIKRNGNTSFMLEDISSSSTRMISSSSSTRREEEELREGSQQDICPPTPPPPPSTSSTRRRKGIPHRAPFGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G384030`
TK1151 ID	TkA02G384030
OH-1004 ID	LXL04_032597
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	84.100
Protein coverage (%)	TK1151 72.816 / OH-1004 80.749 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G384030

Location Chr02:97586928-97590556 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g12646`	May participate in RGF1 peptide signaling regulating root meristem size and root growth.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032597 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010078 maintenance of root meristem identity Biological Process

GO:0043434 response to peptide hormone Biological Process

GO:2000280 regulation of root development Biological Process

GO:2000377 regulation of reactive oxygen species metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G12646

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.588

Rank 1 · TkA02G384030 · TK1151

Cytoplasm0.395

Rank 2 · TkA02G384030 · TK1151

Cell membrane0.086

Rank 3 · TkA02G384030 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA02G384030 · TK1151

Lysosome / Vacuole0.041

Rank 5 · TkA02G384030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00643zf-B_box20-61 aa

PF04640PLATZ25-39 aa

PF02207zf-UBR30-65 aa

PF28307LA_188335-79 aa

PF04640PLATZ62-133 aa

PF00643zf-B_box111-118 aa

PF02207zf-UBR112-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G384030	`PF00643`	zf-B_box	20	61	0.0031	18.4
TkA02G384030	`PF04640`	PLATZ	25	39	2.3e-29	102.5
TkA02G384030	`PF02207`	zf-UBR	30	65	2.7	8.8
TkA02G384030	`PF28307`	LA_1883	35	79	0.37	10.3
TkA02G384030	`PF04640`	PLATZ	62	133	2.3e-29	102.5
TkA02G384030	`PF00643`	zf-B_box	111	118	0.0031	18.4
TkA02G384030	`PF02207`	zf-UBR	112	118	2.7	8.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1G3Q4`	Arabidopsis thaliana	sp\|Q1G3Q4\|RITF1_ARATH Protein RGF1 INDUCIBLE TRANSCRIPTION FACTOR 1	43.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card