TkA02G381370 | RubberDandelionOmics

Gene overview

TkA02G381370

Reference: TK1151 Chr: Chr02 Coordinates: 96948414-96948885 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · TkA02G381370|TK1151|cDNA

ATGGACACTGTTAAAGAAGACGATGTACACGAGTATACTCCAAAGGTGAAGTCTTCACACAGAAGCAAAAGTGTTTCAATATCCATCCCAGTGAGCTCCAGTGAATTGAATTCGGGTGAAAATGATGGTGGTGAACATGGGTGGATACGACAAAAGATATTGTTACTTAAACAATTTAAATATGGGGTCATGAATCCACATGACAAATATGTTAAGCAGTTGAACCAATTCGTTCTCATTTCTTGCCTACTCGCCATTTT...

CDS

Download CDS FASTA

324 bp · TkA02G381370|TK1151|CDS

ATGGACACTGTTAAAGAAGACGATGTACACGAGTATACTCCAAAGGTGAAGTCTTCACACAGAAGCAAAAGTGTTTCAATATCCATCCCAGTGAGCTCCAGTGAATTGAATTCGGGTGAAAATGATGGTGGTGAACATGGGTGGATACGACAAAAGATATTGTTACTTAAACAATTTAAATATGGGGTCATGAATCCACATGACAAATATGTTAAGCAGTTGAACCAATTCGTTCTCATTTCTTGCCTACTCGCCATTTT...

Protein

Download Protein FASTA

107 aa · TkA02G381370|TK1151|PROTEIN

MDTVKEDDVHEYTPKVKSSHRSKSVSISIPVSSSELNSGENDGGEHGWIRQKILLLKQFKYGVMNPHDKYVKQLNQFVLISCLLAIFIDPLFFYLLSVKKVKPRFDT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G381370`
TK1151 ID	TkA02G381370
OH-1004 ID	LXL04_014950
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.400
Protein coverage (%)	TK1151 93.458 / OH-1004 17.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G381370

Location Chr02:96948414-96948885 (+)

Description Similar to CNGC20: Probable cyclic nucleotide-gated ion channel 20, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17700`	Probable cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At3g17690`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014950 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0033198 response to ATP Biological Process

GO:0080027 response to herbivore Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0005216 monoatomic ion channel activity Molecular Function

GO:0005249 voltage-gated potassium channel activity Molecular Function

GO:0005262 calcium channel activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G15990

ath:AT1G19780

ath:AT3G17690

ath:AT3G17700

ath:AT4G30560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.308

Rank 1 · TkA02G381370 · TK1151

Endoplasmic reticulum0.303

Rank 2 · TkA02G381370 · TK1151

Lysosome / Vacuole0.202

Rank 3 · TkA02G381370 · TK1151

Cytoplasm0.157

Rank 4 · TkA02G381370 · TK1151

Golgi apparatus0.127

Rank 5 · TkA02G381370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LD37`	Arabidopsis thaliana	sp\|Q9LD37\|CNG20_ARATH Probable cyclic nucleotide-gated ion channel 20, chloroplastic	48.100%	Swiss-Prot	Medium
`Q9LDR2`	Arabidopsis thaliana	sp\|Q9LDR2\|CNG19_ARATH Putative cyclic nucleotide-gated ion channel 19	39.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card