TkA02G378220 | RubberDandelionOmics

Gene overview

TkA02G378220

Reference: TK1151 Chr: Chr02 Coordinates: 96168119-96172949 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2343 bp · TkA02G378220|TK1151|cDNA

ATGGCAGGTCAAGTGATATTAGTGAGCATGGAGGCGGGTAAAGAGATTACAGATTATGCACTTGAATGGGCGGTTCAAAATGTAATTAAGCCTATGGATTCTCTTATTCTACTTGTGATTATCTCTTCTCAAGAATACAATCCGGTACTTCCCGTCAAGAATTCCCAACCCCGACGTACTACTTCTAAGCGATTATTTTCTCGCATGTTGAAGAAACGGAGTTCTGTTAAAAATGACGTATTAAATAAGGATGGATTTGT...

CDS

Download CDS FASTA

2343 bp · TkA02G378220|TK1151|CDS

ATGGCAGGTCAAGTGATATTAGTGAGCATGGAGGCGGGTAAAGAGATTACAGATTATGCACTTGAATGGGCGGTTCAAAATGTAATTAAGCCTATGGATTCTCTTATTCTACTTGTGATTATCTCTTCTCAAGAATACAATCCGGTACTTCCCGTCAAGAATTCCCAACCCCGACGTACTACTTCTAAGCGATTATTTTCTCGCATGTTGAAGAAACGGAGTTCTGTTAAAAATGACGTATTAAATAAGGATGGATTTGT...

Protein

Download Protein FASTA

780 aa · TkA02G378220|TK1151|PROTEIN

MAGQVILVSMEAGKEITDYALEWAVQNVIKPMDSLILLVIISSQEYNPVLPVKNSQPRRTTSKRLFSRMLKKRSSVKNDVLNKDGFVDDGRDIPQRIYNVCAQMIHHVFSLHKVVKVHTEVKVIAYAPVGSVAMAATELCARWVILDERLKDEADCCLKQYLNCNVVLIEGPYHKILRSVSFPFTMKNDEEQVPTMADMLGAIPAYKQVNNTGVITSSNLSTPSSFNTQKNSYLSTSSSFTSGHVAEKSLPSVAMGSPPR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G378220`
TK1151 ID	TkA02G378220
OH-1004 ID	LXL04_015004
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G378220

Location Chr02:96168119-96172949 (-)

Description Similar to PERK1: Proline-rich receptor-like protein kinase PERK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24550`	Proline-rich receptor-like protein kinase PERK1.	No verified direct reference in this release
`At5g38560`	Could be involved in the negative regulation of root growth.	PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390
`At1g68690`	Could be involved in the negative regulation of root growth.	No verified direct reference in this release
`At1g26150`	Could be involved in the negative regulation of root growth.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015004 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0019901 protein kinase binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G68690

ath:AT3G24550

ath:AT5G38560

smo:SELMODRAFT_444075

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.573

Rank 1 · TkA02G378220 · TK1151

Cytoplasm0.303

Rank 2 · TkA02G378220 · TK1151

Nucleus0.291

Rank 3 · TkA02G378220 · TK1151

Endoplasmic reticulum0.039

Rank 4 · TkA02G378220 · TK1151

Golgi apparatus0.029

Rank 5 · TkA02G378220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07892DUF166722-57 aa

PF07892DUF1667277-308 aa

PF07714PK_Tyr_Ser-Thr410-674 aa

PF00069Pkinase411-673 aa

PF03109ABC1412-439 aa

PF07892DUF1667428-451 aa

PF06734UL97440-539 aa

PF01636APH513-554 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G378220	`PF07892`	DUF1667	22	57	0.09	13.5
TkA02G378220	`PF07892`	DUF1667	277	308	0.09	13.5
TkA02G378220	`PF07714`	PK_Tyr_Ser-Thr	410	674	3.1e-39	135.5
TkA02G378220	`PF00069`	Pkinase	411	673	3.9e-35	122.2
TkA02G378220	`PF03109`	ABC1	412	439	0.019	14.8
TkA02G378220	`PF07892`	DUF1667	428	451	0.09	13.5
TkA02G378220	`PF06734`	UL97	440	539	0.0008	19.4
TkA02G378220	`PF01636`	APH	513	554	0.0034	17.9
TkA02G378220	`PF03109`	ABC1	523	553	0.019	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV48`	Arabidopsis thaliana	sp\|Q9LV48\|PERK1_ARATH Proline-rich receptor-like protein kinase PERK1	44.800%	Swiss-Prot	Low
`Q9FFW5`	Arabidopsis thaliana	sp\|Q9FFW5\|PERK8_ARATH Proline-rich receptor-like protein kinase PERK8	46.400%	Swiss-Prot	Low
`Q9SX31`	Arabidopsis thaliana	sp\|Q9SX31\|PERK9_ARATH Proline-rich receptor-like protein kinase PERK9	47.000%	Swiss-Prot	Low
`Q9C660`	Arabidopsis thaliana	sp\|Q9C660\|PEK10_ARATH Proline-rich receptor-like protein kinase PERK10	45.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card