TkA02G373340 | RubberDandelionOmics

Gene overview

TkA02G373340

Reference: TK1151 Chr: Chr02 Coordinates: 95038094-95040263 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1107 bp · TkA02G373340|TK1151|cDNA

TGGCGTTGATCATCTTTCCATTCTCTCGATTCTTCTCGAGAAACAAATAGGAGGTCGTAGAAAGTCTCCGGTAACCGGAATCGGAGAAAACAGAAGTCTATGTCGGCGACGAATACAAATCAATCTTCCTCGATGGTATCTTCATCTCAAATCACCTACTCGAATGCTCCTTCATATTTTCCCATGCCCTTCCACCTTCAACAACCGATCCCTATGACATTTCCATCGGCGACACCGCCTGTAACGCCGCAGGTTCAATT...

CDS

Download CDS FASTA

537 bp · TkA02G373340|TK1151|CDS

ATGTCGGCGACGAATACAAATCAATCTTCCTCGATGGTATCTTCATCTCAAATCACCTACTCGAATGCTCCTTCATATTTTCCCATGCCCTTCCACCTTCAACAACCGATCCCTATGACATTTCCATCGGCGACACCGCCTGTAACGCCGCAGGTTCAATTCCCTGCTCCTGTCAATGTGTCGGTTGTTCCTTCCGTTTATGCTACCCCTGCTTCCGTTACAGGCGTGTACCTGCCTCAATACCAGCAGGCACAACAACT...

Protein

Download Protein FASTA

178 aa · TkA02G373340|TK1151|PROTEIN

MSATNTNQSSSMVSSSQITYSNAPSYFPMPFHLQQPIPMTFPSATPPVTPQVQFPAPVNVSVVPSVYATPASVTGVYLPQYQQAQQLFQRDAQTITPEALKSVKAALASSEIEHKAETKKKAIPRKAAGQAWEDPTLAEWPENDFRLFCGDLGNEVNDDVLSKAFSRFPSFNMARIFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G373340`
TK1151 ID	TkA02G373340
OH-1004 ID	LXL04_031297
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.500
Protein coverage (%)	TK1151 93.820 / OH-1004 65.984 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G373340`
Location	Chr02:95038094-95040263 (-)
Description	Similar to Rbm42: RNA-binding protein 42
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031297` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000387 spliceosomal snRNP assembly Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0048025 negative regulation of mRNA splicing, via spliceosome Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005737 cytoplasm Cellular Component GO:0046540 U4/U6 x U5 tri-snRNP complex Cellular Component GO:0071011 precatalytic spliceosome Cellular Component GO:0003723 RNA binding Molecular Function GO:0003729 mRNA binding Molecular Function
KEGG gene cross-reference	bta:540172 hsa:79171 mmu:68035 rno:361545 xtr:493283 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.679

Rank 1 · TkA02G373340 · TK1151

Cytoplasm0.417

Rank 2 · TkA02G373340 · TK1151

Mitochondrion0.027

Rank 3 · TkA02G373340 · TK1151

Cell membrane0.024

Rank 4 · TkA02G373340 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkA02G373340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076RRM_1147-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G373340	`PF00076`	RRM_1	147	177	0.064	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card