TkA02G373190 | RubberDandelionOmics

Gene overview

TkA02G373190

Reference: TK1151 Chr: Chr02 Coordinates: 94982637-94983817 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

920 bp · TkA02G373190|TK1151|cDNA

AAATAATCCAGAAAAAACACCATTAACACCCATGAGATTTCATGTCCTTTCATGGTCATTCATATAGAGAATTGGCGGAACCAAATGCATGTCCACCCTATCCCCAAACCCAAATCCTTTTCCCGATTCCCAGAAAATATAAACCCTGCATTTCATTACAACAACAAGATATTTCAATTTGTGATCAATAGCACCTGCTTTCTTCTCCAGATTTCGAATTCTGGGATCATTGCATGGGCGGTTTTAGCTGAGAGGGATTG...

CDS

Download CDS FASTA

705 bp · TkA02G373190|TK1151|CDS

ATGGTCATTCATATAGAGAATTGGCGGAACCAAATGCATGTCCACCCTATCCCCAAACCCAAATCCTTTTCCCGATTCCCAGAAAATATAAACCCTGCATTTCATTACAACAACAAGATATTTCAATTTGTGATCAATAGCACCTGCTTTCTTCTCCAGATTTCGAATTCTGGGATCATTGCATGGGCGGTTTTAGCTGAGAGGGATTGGGTAATGGATAATTTGCTGGGTCTTCTTAGAATTAGGGTTAAAAGAGGTAT...

Protein

Download Protein FASTA

234 aa · TkA02G373190|TK1151|PROTEIN

MVIHIENWRNQMHVHPIPKPKSFSRFPENINPAFHYNNKIFQFVINSTCFLLQISNSGIIAWAVLAERDWVMDNLLGLLRIRVKRGIDLAIRDFRSSDPYVVVTMGDQKLKTGVVDKNLNPVWEEDLTLPVQNTELPVTLMVFDHDLFTKDDEMGDAEFGIQPFYEAVKMHPDSNTVPNGTILKRVSPDRDNCLSEESVVTWKDGKVTQNMTLRLRNVECGEIELDLFWIEVPK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G373190`
TK1151 ID	TkA02G373190
OH-1004 ID	LXL04_015033
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G373190

Location Chr02:94982637-94983817 (-)

Description Similar to CAR4: Protein C2-DOMAIN ABA-RELATED 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48590`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	C2-domain abscisic acid-related proteins mediate the interaction of PYR/PYL/RCAR abscisic acid receptors with the plasma membrane and regulate abscisic acid sensitivity in Arabidopsis.2014 · DOI: 10.1105/tpc.114.129973
`At3g17980`	Mediates the transient calcium-dependent interaction of PYR/PYL/RCAR abscisic acid (ABA) receptors with the plasma membrane and thus regulates ABA sensitivity.	The unconventional P-loop NTPase OsYchF1 and its regulator OsGAP1 play opposite roles in salinity stress tolerance.2013 · DOI: 10.1111/pce.12108 C2-domain abscisic acid-related proteins mediate the interaction of PYR/PYL/RCAR abscisic acid receptors with the plasma membrane and regulate abscisic acid sensitivity in Arabidopsis.2014 · DOI: 10.1105/tpc.114.129973
`At1g73580`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	No verified direct reference in this release
`At5g37740`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	C2-domain abscisic acid-related proteins mediate the interaction of PYR/PYL/RCAR abscisic acid receptors with the plasma membrane and regulate abscisic acid sensitivity in Arabidopsis.2014 · DOI: 10.1105/tpc.114.129973
`At1g70790`	Stimulates the GTPase/ATPase activities of Obg-like ATPases (By similarity).	C2-domain abscisic acid-related proteins mediate the interaction of PYR/PYL/RCAR abscisic acid receptors with the plasma membrane and regulate abscisic acid sensitivity in Arabidopsis.2014 · DOI: 10.1105/tpc.114.129973 LOWER TEMPERATURE 1 Enhances ABA Responses and Plant Drought Tolerance by Modulating the Stability and Localization of C2-Domain ABA-Related Proteins in Arabidopsis.2019 · DOI: 10.1016/j.molp.2019.05.002

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015033 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0043547 positive regulation of GTPase activity Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G48590

ath:AT1G66360

ath:AT1G73580

ath:AT3G17980

ath:AT5G37740

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.325

Rank 1 · TkA02G373190 · TK1151

Cell membrane0.263

Rank 2 · TkA02G373190 · TK1151

Nucleus0.258

Rank 3 · TkA02G373190 · TK1151

Endoplasmic reticulum0.128

Rank 4 · TkA02G373190 · TK1151

Golgi apparatus0.098

Rank 5 · TkA02G373190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168C228-49 aa

PF00168C277-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G373190	`PF00168`	C2	28	49	1.2e-21	77.6
TkA02G373190	`PF00168`	C2	77	163	1.2e-21	77.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LP65`	Arabidopsis thaliana	sp\|Q9LP65\|CAR5_ARATH Protein C2-DOMAIN ABA-RELATED 5	62.600%	Swiss-Prot	Medium
`Q9LVH4`	Arabidopsis thaliana	sp\|Q9LVH4\|CAR4_ARATH Protein C2-DOMAIN ABA-RELATED 4	60.100%	Swiss-Prot	High
`Q9C6B7`	Arabidopsis thaliana	sp\|Q9C6B7\|CAR3_ARATH Protein C2-DOMAIN ABA-RELATED 3	54.000%	Swiss-Prot	Medium
`Q9FHP6`	Arabidopsis thaliana	sp\|Q9FHP6\|CAR1_ARATH Protein C2-DOMAIN ABA-RELATED 1	58.300%	Swiss-Prot	Medium
`Q9S7J9`	Arabidopsis thaliana	sp\|Q9S7J9\|CAR9_ARATH Protein C2-DOMAIN ABA-RELATED 9	55.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card