TkA02G372830 | RubberDandelionOmics

Gene overview

TkA02G372830

Reference: TK1151 Chr: Chr02 Coordinates: 94872187-94873917 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1020 bp · TkA02G372830|TK1151|cDNA

AATATAGTCTACAGCTAACAGCTCTACACCCATCCAATCACCCATTCACCCCCATAGTTTGGGTCTCTGCACTGGGGACTGCTAAATAGCAATCCCTTCGTCCTCCGGCAGCAACTATATGGCGGCAACAATGGGTGGCGCCTTTAACTCTTCGTCATGCCCATCCATAACGCTCTTCAGGAGGAGCACCGGTGTTACTAGGATAAGCGATAACTTCGAGAGAACCAGACAACAATGTCGGTTATCTTCTTCCTTTTGTT...

CDS

Download CDS FASTA

633 bp · TkA02G372830|TK1151|CDS

ATGGCGGCAACAATGGGTGGCGCCTTTAACTCTTCGTCATGCCCATCCATAACGCTCTTCAGGAGGAGCACCGGTGTTACTAGGATAAGCGATAACTTCGAGAGAACCAGACAACAATGTCGGTTATCTTCTTCCTTTTGTTGTACACCAGTTAATAGCTGTTCTCCGTTGCCTGTTTTCTCTTCTACGCTTTCAAATGCTTCTTCCAAACTCCATAAGTCTCCTCAAGTTGTAGCCTGTGCCCCTTCGTCACAGCCAGA...

Protein

Download Protein FASTA

210 aa · TkA02G372830|TK1151|PROTEIN

MAATMGGAFNSSSCPSITLFRRSTGVTRISDNFERTRQQCRLSSSFCCTPVNSCSPLPVFSSTLSNASSKLHKSPQVVACAPSSQPEKTTTAFTSSTKLYVSDFEGLIAIDSKAVPVNLQFGLSFRTSEEGLRNAFQSFGQLIDVNLVMDKIANRSRGFAFLRYATKEESEKAIEGMHGKFLDGRVIFVEYAKPRSQLNQVIKQDQKPYQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G372830`
TK1151 ID	TkA02G372830
OH-1004 ID	LXL04_015041
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G372830

Location Chr02:94872187-94873917 (+)

Description Similar to ORRM6: Organelle RRM domain-containing protein 6, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73530`	Involved in C-to-U editing of chloroplastic RNA.	An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing.2017 · DOI: 10.1104/pp.16.01623
`At5g54580`	Involved in C-to-U editing of mitochondrial RNA.	Two RNA recognition motif-containing proteins are plant mitochondrial editing factors.2015 · DOI: 10.1093/nar/gkv245
`At3g20930`	Involved in C-to-U editing of chloroplastic RNA.	An RNA recognition motif-containing protein is required for plastid RNA editing in Arabidopsis and maize.2013 · DOI: 10.1073/pnas.1220162110
`At5g06210`	Probable RNA-binding protein that may be involved in salt and oxidative stress tolerance.	The Arabidopsis chloroplast protein S-RBP11 is involved in oxidative and salt stress responses.2014 · DOI: 10.1007/s00299-013-1560-9

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0730800`	Involved in C-to-U editing of chloroplastic RNA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015041 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0016554 cytidine to uridine editing Biological Process

GO:0080156 mitochondrial mRNA modification Biological Process

GO:1900871 chloroplast mRNA modification Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G73530

ath:AT5G06210

ath:AT5G54580

dosa:Os02g0730800

osa:4330618

zma:100304402

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.952

Rank 1 · TkA02G372830 · TK1151

Nucleus0.047

Rank 2 · TkA02G372830 · TK1151

Mitochondrion0.040

Rank 3 · TkA02G372830 · TK1151

Cytoplasm0.018

Rank 4 · TkA02G372830 · TK1151

Cell membrane0.010

Rank 5 · TkA02G372830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076RRM_1122-187 aa

PF28976RRM_ACIN1132-180 aa

PF05172RRM_Nup35134-192 aa

PF00076RRM_1188-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G372830	`PF00076`	RRM_1	122	187	3.7e-16	59.5
TkA02G372830	`PF28976`	RRM_ACIN1	132	180	0.22	12.4
TkA02G372830	`PF05172`	RRM_Nup35	134	192	0.043	14.5
TkA02G372830	`PF00076`	RRM_1	188	196	3.7e-16	59.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX45`	Arabidopsis thaliana	sp\|Q9FX45\|ORRM6_ARATH Organelle RRM domain-containing protein 6, chloroplastic	71.400%	Swiss-Prot	Low
`Q9FIU6`	Arabidopsis thaliana	sp\|Q9FIU6\|ORRM2_ARATH Organelle RRM domain-containing protein 2, mitochondrial	60.200%	Swiss-Prot	Low
`Q8L440`	Arabidopsis thaliana	sp\|Q8L440\|ORRM1_ARATH Organelle RRM domain-containing protein 1, chloroplastic	49.400%	Swiss-Prot	Low
`Q9FFZ6`	Arabidopsis thaliana	sp\|Q9FFZ6\|RBP11_ARATH Small RNA-binding protein 11, chloroplastic	45.100%	Swiss-Prot	Low
`Q6YWP9`	Oryza sativa subsp. japonica	sp\|Q6YWP9\|ORRM1_ORYSJ Organelle RRM domain-containing protein 1, chloroplastic	47.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card