RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G371140
Reference: TK1151 Chr: Chr02 Coordinates: 94467292-94471593 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1293 bp · TkA02G371140|TK1151|cDNA

ATGTCCAAGTTCGGTGATAGTTTCCGAAACACTTTGAACAACCAAATGAATGAACATTTAAAATTGTTTAGTTCAATCAAAGTTTTGGTGGTTGACCACAAGATGGACTTCCTTGGTTATGTTGTTGACATGCTACATTCTTGTTCATTTGAAGTTACATGTGTTGATCATGCCGGTGCGGCTTTGAAATTGCTCTCGAAAAAGAAGAGTGAGTTTGACCTCGTCCTCATAGACAGTGGCATGAGGGATGTGGATGTTCA...

CDS

Download CDS FASTA

1293 bp · TkA02G371140|TK1151|CDS

ATGTCCAAGTTCGGTGATAGTTTCCGAAACACTTTGAACAACCAAATGAATGAACATTTAAAATTGTTTAGTTCAATCAAAGTTTTGGTGGTTGACCACAAGATGGACTTCCTTGGTTATGTTGTTGACATGCTACATTCTTGTTCATTTGAAGTTACATGTGTTGATCATGCCGGTGCGGCTTTGAAATTGCTCTCGAAAAAGAAGAGTGAGTTTGACCTCGTCCTCATAGACAGTGGCATGAGGGATGTGGATGTTCA...

Protein

Download Protein FASTA

430 aa · TkA02G371140|TK1151|PROTEIN

MSKFGDSFRNTLNNQMNEHLKLFSSIKVLVVDHKMDFLGYVVDMLHSCSFEVTCVDHAGAALKLLSKKKSEFDLVLIDSGMRDVDVHTFLSLAKNMDVLTIVMSEQDDDAFLIEALMGGAFLVLKRPLTIDAVRHMRQDIIRERMHKHVENSKNKNMILKAKTQAVTTPENSNKRKERNEPMKQVSRPNYQSSQDDDDDDDDHSTKKKLCIEWTRELHQKFLDAISELGEGRCFPKEILHLMDVPGLTRMQVASHLQKCR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G371140
TK1151 IDTkA02G371140
OH-1004 IDLXL04_015062
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)99.300
Protein coverage (%)TK1151 100.000 / OH-1004 77.758
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G371140
LocationChr02:94467292-94471593 (+)
DescriptionSimilar to ARR2: Two-component response regulator ARR2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g58080 Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. No verified direct reference in this release
At4g16110 Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.
The response regulator ARR2: a pollen-specific transcription factor involved in the expression of nuclear genes for components of mitochondrial complex I in Arabidopsis.2001 · DOI: 10.1007/s004380000400
Two-component circuitry in Arabidopsis cytokinin signal transduction.2001 · DOI: 10.1038/35096500
The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis.2004 · DOI: 10.1038/sj.emboj.7600337
Cytokinin-mediated control of leaf longevity by AHK3 through phosphorylation of ARR2 in Arabidopsis.2006 · DOI: 10.1073/pnas.0505150103

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0904700 Transcriptional activator that binds specific DNA sequence. No verified direct reference in this release
UniProt: A2XE31 Transcriptional activator that binds specific DNA sequence. No verified direct reference in this release
Os03g0224200 Transcriptional activator that binds specific DNA sequence. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_015062 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000160 phosphorelay signal transduction system Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009723 response to ethylene Biological Process
GO:0009735 response to cytokinin Biological Process
GO:0009736 cytokinin-activated signaling pathway Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0010082 regulation of root meristem growth Biological Process
GO:0010119 regulation of stomatal movement Biological Process
GO:0010150 leaf senescence Biological Process
GO:0010380 regulation of chlorophyll biosynthetic process Biological Process
GO:0010492 maintenance of shoot apical meristem identity Biological Process
KEGG gene cross-reference
ath:AT3G16857
ath:AT4G16110
dosa:Os01g0904700
dosa:Os02g0182100
osa:4325022
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971
Rank 1 · TkA02G371140 · TK1151
Cytoplasm0.084
Rank 2 · TkA02G371140 · TK1151
Cell membrane0.026
Rank 3 · TkA02G371140 · TK1151
Endoplasmic reticulum0.016
Rank 4 · TkA02G371140 · TK1151
Plastid0.011
Rank 5 · TkA02G371140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21424DTP-pb9_A-dom_C5-14 aa
PF00072Response_reg28-134 aa
PF27690UCP00454693-163 aa
PF12722Hid1121-280 aa
PF21106YtxK_like130-172 aa
PF30675FAM133150-197 aa
PF11596DUF3246155-203 aa
PF00249Myb_DNA-binding212-259 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G371140PF21424DTP-pb9_A-dom_C5149.16.8
TkA02G371140PF00072Response_reg281342.7e-0834.7
TkA02G371140PF27690UCP004546931630.05514.3
TkA02G371140PF12722Hid11212800.02813.4
TkA02G371140PF21106YtxK_like1301720.09913.7
TkA02G371140PF30675FAM1331501977.77.5
TkA02G371140PF11596DUF32461552030.919.6
TkA02G371140PF00249Myb_DNA-binding2122591.3e-0629.1
TkA02G371140PF21106YtxK_like2152710.09913.7
TkA02G371140PF30675FAM1332552847.77.5
TkA02G371140PF11596DUF32462662960.919.6
TkA02G371140PF21424DTP-pb9_A-dom_C2782859.16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FGT7Arabidopsis thalianasp|Q9FGT7|ARR18_ARATH Two-component response regulator ARR1831.600%Swiss-ProtMedium
Q9ZWJ9Arabidopsis thalianasp|Q9ZWJ9|ARR2_ARATH Two-component response regulator ARR232.900%Swiss-ProtMedium
Q5N6V8Oryza sativa subsp. japonicasp|Q5N6V8|ORR26_ORYSJ Two-component response regulator ORR2631.800%Swiss-ProtMedium
A2XE31Oryza sativa subsp. indicasp|A2XE31|ORR21_ORYSI Two-component response regulator ORR2132.700%Swiss-ProtMedium
Q8H7S7Oryza sativa subsp. japonicasp|Q8H7S7|ORR21_ORYSJ Two-component response regulator ORR2132.700%Swiss-ProtMedium

JBrowse

View in Genome Browser