TkA02G367950 | RubberDandelionOmics

Gene overview

TkA02G367950

Reference: TK1151 Chr: Chr02 Coordinates: 93622745-93623899 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1086 bp · TkA02G367950|TK1151|cDNA

ATGTCAGACGTCCTACCTTTCCATATCCATGAAGAAATCCTGAAAATGCTTCCTATCAAATCATTGATTCAGTTCAGATCCGTTTCAAAAACTTGGAAGTCTTTGATTGATAGCTTAGAATTCATCTCTGCTCACAGCCACCACCACAATCGGCCACAACATCTGCTTGTATCGTACCAAGAACCGATACCCAGAGAAACAAAATATGTTTCTTTTGTTGACGATGACTCTTTCCCCCAACAGAGGTTTGTTCCAACTTT...

CDS

Download CDS FASTA

1086 bp · TkA02G367950|TK1151|CDS

ATGTCAGACGTCCTACCTTTCCATATCCATGAAGAAATCCTGAAAATGCTTCCTATCAAATCATTGATTCAGTTCAGATCCGTTTCAAAAACTTGGAAGTCTTTGATTGATAGCTTAGAATTCATCTCTGCTCACAGCCACCACCACAATCGGCCACAACATCTGCTTGTATCGTACCAAGAACCGATACCCAGAGAAACAAAATATGTTTCTTTTGTTGACGATGACTCTTTCCCCCAACAGAGGTTTGTTCCAACTTT...

Protein

Download Protein FASTA

361 aa · TkA02G367950|TK1151|PROTEIN

MSDVLPFHIHEEILKMLPIKSLIQFRSVSKTWKSLIDSLEFISAHSHHHNRPQHLLVSYQEPIPRETKYVSFVDDDSFPQQRFVPTFPPSITLPRIVGSSYGLLCLDCSLWELQSYRRTMSVLWNPSIRKSIAIVVPDMPDMSFTGHDTFLGFGVCPVTIDPKIVHITQFRPFKVYKLSSGKCKSLSRNLPSILIRVRRPQVVINRFIYCTSRSRDLIMSFDLIDENFKVVDLPNSIANPPPTDFSISKLRESLVMIVCN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G367950`
TK1151 ID	TkA02G367950
OH-1004 ID	LXL04_015107
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G367950

Location Chr02:93622745-93623899 (-)

Description Similar to CPR1: F-box protein CPR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43190`	F-box/kelch-repeat protein At5g43190.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015107 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042177 negative regulation of protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G47790

ath:AT1G52495

ath:AT2G21930

ath:AT3G07870

ath:AT4G12560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.692

Rank 1 · TkA02G367950 · TK1151

Nucleus0.420

Rank 2 · TkA02G367950 · TK1151

Cell membrane0.083

Rank 3 · TkA02G367950 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA02G367950 · TK1151

Lysosome / Vacuole0.034

Rank 5 · TkA02G367950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like4-37 aa

PF00646F-box5-41 aa

PF08268FBA_397-281 aa

PF12937F-box-like104-111 aa

PF07734FBA_1118-319 aa

PF00646F-box183-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G367950	`PF12937`	F-box-like	4	37	0.00065	20.1
TkA02G367950	`PF00646`	F-box	5	41	2.3e-10	40.6
TkA02G367950	`PF08268`	FBA_3	97	281	1.8e-07	31.2
TkA02G367950	`PF12937`	F-box-like	104	111	0.00065	20.1
TkA02G367950	`PF07734`	FBA_1	118	319	2.3e-05	24.3
TkA02G367950	`PF00646`	F-box	183	190	2.3e-10	40.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHS6`	Arabidopsis thaliana	sp\|Q9FHS6\|FK119_ARATH F-box/kelch-repeat protein At5g43190	33.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card